KEGG   Mus musculus (mouse): 52679
Entry
52679             CDS       T01002                                 

Symbol
E2f7, A630014C11Rik, D10Ertd739e, E2F-7
Name
(RefSeq) E2F transcription factor 7
  KO
K09391  transcription factor E2F7/8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    52679 (E2f7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    52679 (E2f7)
SSDB
Motif
Pfam: E2F_TDP TrmB
Other DBs
NCBI-GeneID: 52679
NCBI-ProteinID: NP_848724
MGI: 1289147
Ensembl: ENSMUSG00000020185
Vega: OTTMUSG00000037938
UniProt: Q6S7F2
Position
10 D1; 10 57.74 cM
AA seq 904 aa
MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNEPIDLSKQRIF
TPDRNPITPVKPVDRQPQVEPWTPTANLKMLISAASPDIRDREKKKELFRPIENKEDAFV
NSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSL
GVERRRIYDIVNVLESLHLVSRVAKNQYGWHGRHSLPKTLRTLQRLGEEQKYEEQMACLQ
QKELDLMGYRFGERRKDGSPDPRDPHLLDFSEADYPSSSANSRKDKSLRIMSQKFVMLFL
VSKTKIVTLDVAAKILIEESQDTPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGR
KPAFKWIGPVDFSSIDEELLDVSASILPELKKEAYGQIRVCAKERLVRYGSFNTVHTSEK
IQRKVSSEPSSPQGERQGSAYSLEIGSLAAIYRQKVEDNSQEEAFVSNTAVPPASILDPA
LSMDSEYCVKPLAQPVFSVAQTDLPAFSAQNGPSGQVGVPVPSAASDTENLKPALLAGQP
LVYVPSTQLFMLYGSVQEGLSPESRSEEDGGGSDVPADLSVTPSAQKRLCEERDPQEEED
EPAMKRQSQEFEDSPLSLVMPKKPSSSTDLACPVTMGNGSSPPLEDACVKGQLPAAEEVT
GKAAPNCYVASECGNPARNPDTEKPSNENEITKDPSLMQYLYVQSPAGLNGFNMVLPGTQ
TPHTVAPSPAQLPSFGVPCMFLQSPGLGPFPVLYSPAIPGPISSAPGTHPNPGPMNFGLS
TLASASHLLISPAAMVNPKPSTLPCTDPQLRCQPSLNLNPVMPGSHGVIHPESPCYVRHP
VSMVKAEQSPAPATPKSIQRRHRETFFKTPGSLGDPVFRRKERNQSRNTSSAQRRLEISS
SGPD
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggaggtgaattgtttaacactaaaagacttgatcagccccaggcagaccagactagat
tttgccattgaagatgcagagaacgcacaaaaggaaaatatatttgtcgaccgatcaagg
atgaccccaaagacaccgatgaagaacgagccgatcgacctgtcaaagcaaagaatcttc
accccagacagaaaccccattactccagtaaagccggtcgacaggcagccgcaggtggag
ccctggacacccacagccaacctgaagatgctcatcagcgccgccagcccagacataaga
gaccgggagaagaaaaaggagctgttcagacccattgagaataaggaggatgcgttcgtg
aactccctgcagcttgacgtggccggtgacggcgctgtggatgagtatgagaagcaaagg
ccaagcaggaaacagaagagcttggggctgctgtgccagaagtttctagctcgctatccg
agctaccccttgtcaacggagaaaaccaccatctccctagatgaggtcgccgtcagtctc
ggcgtggaaaggagacgcatctatgacatcgtaaacgtgctggagtcgctgcatctggtc
agccgggtggctaagaatcagtatggttggcacggtcggcacagcctccccaaaaccctg
aggaccctacagagactgggagaggaacagaaatacgaggagcagatggcctgcctccag
cagaaggagctggacctgatggggtataggttcggagaacgcaggaaagacgggtctccg
gacccccgagatccacacctacttgatttttccgaagccgactacccctcttcatctgca
aacagtcgaaaagataaatctttaagaattatgagccagaagtttgtcatgctgttcctc
gtctccaaaaccaagattgtcaccctggatgtagctgccaaaatcctcatagaagaaagc
caagataccccggaccacagcaaattcaaaacaaaggtacggaggctctatgacatagcc
aatgttctgaccagcctggctctgataaagaaagttcacgtaacagaagagcgaggccgg
aaaccagccttcaagtggatcgggcctgtggacttcagctccattgatgaagaactgttg
gacgtctctgcatccatcttaccagaattgaagaaggaagcatacggccagatccgagtg
tgtgcaaaagagaggctggtgcggtacggttcctttaacacggttcacacgtctgagaag
atacagagaaaagtgagctcagaacccagcagcccacagggagaaagacaagggtcagcc
tattccctggaaattggaagtctggcggccatctacagacagaaagtagaagataattcg
caggaggaagcctttgtcagtaacacagcagtgcctccagcaagcatcttggaccccgcc
ctctccatggactctgaatactgtgtcaagcctttagcccagccagtattttctgttgct
caaacagatttgccggccttctctgcgcagaatggtccaagcggacaagtaggtgtcccc
gttccttctgcagcctccgacacagagaacttaaagccagctctgctcgccggccagccc
ctggtctacgtgccctccacccaactcttcatgctgtacgggagtgtgcaggagggactg
tccccagagtcaaggtcagaggaagatggtggtggctccgatgtcccagctgacctgtca
gtgacaccctctgctcagaagcgcctgtgtgaggagagagatcctcaggaggaggaggac
gagcccgccatgaaaagacaaagtcaggaatttgaagacagccccttatccctagttatg
cccaagaaaccctcaagttccacagaccttgcctgtcctgtgaccatgggaaacgggagc
tctccacccctggaagacgcctgtgttaagggtcagctccctgctgcagaagaagttaca
ggaaaggctgccccaaactgctatgttgcttctgagtgtggaaacccggcaagaaatcca
gacactgaaaagccttccaacgaaaacgagatcaccaaagacccctcgctgatgcagtac
ctgtatgtgcagtctcccgcagggttaaatggttttaacatggttttaccaggcacccag
accccccacaccgtggcaccctccccggctcagctgccatccttcggcgtaccctgcatg
ttcctgcaatccccaggcctgggcccttttccagttctctattctcccgcaatacccggg
cccatttcttcagcccccggcactcacccaaaccccggacccatgaacttcggcttgtcc
accctggcatctgcttctcaccttctcatcagcccggcagccatggtcaatccaaagcca
tccaccctcccctgtacagaccctcagcttcgctgtcagccctcactcaacctgaacccc
gtgatgccaggctcacacggcgtcatccaccccgagtccccctgttacgtgagacatccg
gtatcgatggtaaaggcagagcagtcccctgcaccggcgactcccaagagcatccaacgg
agacatcgggagacgttcttcaagactcccggcagcctcggcgatccggtctttagaaga
aaagaaaggaaccaatcaagaaacactagctcagcccagaggagactagaaatctctagc
agcgggcctgactag

DBGET integrated database retrieval system