KEGG   Mus musculus (mouse): 52710
Entry
52710             CDS       T01002                                 

Gene name
Slc52a2, 2010003P03Rik, D15Ertd747e, GPCR42, Gpr172b, PAR2, RFT1, mRFT1
Definition
(RefSeq) solute carrier protein 52, member 2
  KO
K22117  riboflavin transporter 1/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    52710 (Slc52a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC52: Riboflavin transporter
   52710 (Slc52a2)
SSDB
Motif
Pfam: DUF1011
Other DBs
NCBI-GeneID: 52710
NCBI-ProteinID: NP_083919
MGI: 1289288
Ensembl: ENSMUSG00000022560
UniProt: Q9D8F3
Position
15 D3; 15 36.04 cM
AA seq 450 aa
MAAPPLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNL
GLLLVTLWRRLARGKGEQVPIRVVQGLGIVGTGLLASLWNHVAPVAGKPYSVAFLTLAFV
LALACCASNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALGQGVGRLECLHVPANRT
TGPPIEVSPINFPERFSATTFFWVLTALLGTSAAAFQGLLLLLPSPTSEPTTGTGLRVET
PGTEEEEEEEEASPLQEPPGQVAGIVSSPDPKAHQLFSSRSACLLGLLAITNALTNGVLP
AVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVLCRSLAGLCGLSLLGMLLGSYLMT
LAALSPCPPLVGTSAGVVLVVLSWVLCAGTFSYIKVAISSMLHSGGRPALLAAGVAIQVG
SLLGAVAMFPPTSIYRVFRSGKDCVDQCGL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggcagcacctccgctgggccgactggtgctgacccatctgctggtggcccttttcggc
atgggctcctgggctgctgtcaacgggatctgggtagagctgccggtagtggtgaaagag
ctcccggagggttggagcctcccttcctacctctctgtgcttgtggcgctgggaaacctg
ggtctgctgctggtgactctgtggaggcgtctggctcgcggcaagggcgagcaagtcccc
atccgagtggttcaggggctaggcatagtgggcacaggcctactggcctctctgtggaac
cacgtggccccagtggcaggaaagccgtactcagtggccttcctaacgctggcgtttgtg
ctggcattggcctgctgtgcttctaatgtcactttcctgcccttcttgagccacctccca
cccccctttttacggtctttcttcctgggtcagggcctgagtgccctcctgccctgtgtg
ctagccctgggtcaaggggtgggccgccttgagtgcctgcatgtgcctgccaacaggacc
actgggcctccgatcgaggtgtctcccattaatttccctgaacggttttctgccaccacg
ttcttctgggtgttgactgcccttctgggcacttcagcagctgccttccaaggcctcctg
ttactactgccatccccgacatctgaacccacaacaggtacagggcttcgggtagaaaca
ccaggaacagaggaggaagaggaagaggaagaggcctcacctttgcaggagccaccaggc
caggtggcaggcattgtttccagcccagaccctaaggcccatcagctgttctcttcccga
agtgcctgtctactgggcctgctggccatcaccaatgctctgaccaatggcgtgctgccc
gctgtacagagcttttcctgcctgccctatgggcgcctggcctaccacttggctgtcgta
ctgggtagctgtgccaacccccttgcctgctttctggccatggcagtgctgtgcaggtct
ctggcagggctgtgtggtctgtctctgctgggcatgctcttgggctcctacctgatgaca
ctggcagccttaagtccctgtcctcctctggtgggcacctctgcaggtgtggtcctcgtg
gtactctcatgggtcctgtgcgcaggcacgttctcgtatatcaaggtggcgatcagttcc
atgttacacagcggaggccggccagcactgctcgctgctggcgtggctattcaggtgggc
tctctgctgggtgcggtcgccatgttccctcctaccagcatctaccgagtatttcgcagc
ggaaaggactgtgtggaccagtgtggcctctga

DBGET integrated database retrieval system