KEGG   Mus musculus (mouse): 52713Help
Entry
52713             CDS       T01002                                 

Gene name
Ccdc59, 2300004H16Rik, D10Ertd718e
Definition
(RefSeq) coiled-coil domain containing 59
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: rRNA_processing SNX17_FERM_C
Motif
Other DBs
NCBI-GeneID: 52713
NCBI-ProteinID: NP_079878
MGI: 1289302
Ensembl: ENSMUSG00000019897
Vega: OTTMUSG00000032766
UniProt: Q8R2N0
Position
10 D1; 10 55.12 cM
AA seq 240 aa AA seqDB search
MAPSRPSSKWRTGGFAARGEGISQVRFGNQNGKRRTWRPNPQQAFRGSVRKGQGFAFRRK
LKIQQNYKKLLWKVKEAPASQESQFTDRYPEHLKHLYLAEEERLRKQQRKAGLALSEEQV
DRPLPEEEGSTEQTSSEEPPGGHQPQPEELNTGSSVTFPKNKKKKTSNQKAQEEYERVQA
KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQMEYLLQKIQENS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcgcggccgtcttccaagtggcggaccggagggtttgcggcgcgtggggaa
gggatctctcaggtcagattcggaaaccagaatgggaagcgcaggacttggcggccgaac
ccccagcaagccttccgggggagcgtgcgcaagggacaaggttttgcatttcggagaaaa
ctgaagatccagcaaaattacaagaaattgctgtggaaggtgaaggaggcaccagcgtca
caggagtcccagttcacagatcgttacccagagcacctgaaacacctctatctggccgaa
gaggaaagactcagaaaacagcaaagaaaggctggcctggctttgtcagaagaacaggtt
gaccggcctttgcctgaagaggagggcagcactgagcagacttcctctgaagaaccgcca
ggtggtcaccagccacagccagaagagctgaacacaggaagttctgtgacttttccaaag
aataagaaaaagaaaacttcaaaccagaaggcacaagaagagtatgaacgagtacaagcg
aagcgtgctgctaagaaatttgaatttgaaatgagaaagcaagagagagaagaggctcaa
aggctctacaaaaagaaaaaaatggaagctttcaaaatactgagcaaaaagactaaaaag
ggccagcctaacctgaatttacagatggagtatcttctgcagaaaatacaagaaaacagt
taa

DBGET integrated database retrieval system