KEGG   Mus musculus (mouse): 52717Help
Entry
52717             CDS       T01002                                 

Gene name
Anapc16, 2310005G07Rik, APC16, D10Ertd641e
Definition
(RefSeq) anaphase promoting complex subunit 16
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC16 DUF2110
Motif
Other DBs
NCBI-GeneID: 52717
NCBI-ProteinID: NP_079790
MGI: 1289325
Ensembl: ENSMUSG00000020107
Vega: OTTMUSG00000043347
UniProt: Q9CPV2
Position
10 B4; 10 29.66 cM
AA seq 110 aa AA seqDB search
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcctcgtcttcgtcttcagctggtggggtcagtggaagctctgtcaccgga
tctggtttcagtgtgtccgaccttgccccacctcggaaagctctgttcacctacccgaaa
ggagctggagagatgttagaagatggctccgagcgattcctctgtgagtcggtgtttagc
tatcaagtggcatccacgcttaaacaggtgaagcatgatcagcaagtcgctcggatggaa
aaactggctggtctggtggaagagctggaggccgacgagtggcggtttaaacccatcgag
cagctgctggggttcacaccctcctcgggctga

DBGET integrated database retrieval system