KEGG   Mus musculus (mouse): 52837Help
Entry
52837             CDS       T01002                                 

Gene name
Tmx4, 2810417D04Rik, 4930500L08Rik, AI843224, AW046784, D2Bwg1356e, Txndc13, mKIAA1162
Definition
(RefSeq) thioredoxin-related transmembrane protein 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin DUF4834 CDC45 MAP17 SID-1_RNA_chan UPF0239 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 52837
NCBI-ProteinID: NP_083424
MGI: 106558
Ensembl: ENSMUSG00000034723
Vega: OTTMUSG00000015451
UniProt: Q8C0L0 Q0P5W2
Position
2 F2; 2 65.66 cM
AA seq 335 aa AA seqDB search
MTGGFCVPVLLAAWLAAAAAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWC
PSCQQTDSEWETFAKNGETLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRG
PGIYEDLQNYILEKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIP
AWCSYVFFVIATLVFGLFMGLILVVISECFCVPLPRASSERCEQEQSTGEAQGAEQLQDA
EEEKDDSNEEENKDSLVDDEEEKEDIGDEDEGEEDEEEDNLAGIMAEERSDTNERAVVKE
GSVSPKEDGAHPADTQDVVEDALRQRKSQNANKGS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcggcttctgcgtcccggtactcctggccgcctggctcgcagcggcagcggcc
gagggtctcgagcaggccgcgctgccggccgaggagagccgtgtgcagcccatgaccgcc
tccaactggacgctggtgatggagggcgagtggatgctgaaattttatgctccatggtgt
ccatcctgccagcagactgattctgaatgggagacttttgcaaagaatggagaaacactt
cagatcagtgtgggaaaggtggatgtcattcaagagccaggtttgagtggccgcttcttt
gtcaccactctcccagcattttttcatgcaaaagatgggatattccgccgttaccgtggt
ccaggaatctatgaagatttacagaattacatattagagaagaaatggcaatcagttgag
cctctcactggctggaagtccccagcctctctaacgatgtctggaatggctggtcttttt
agcatctctggcaagatttggcaccttcacaactatttcacagtgacccttggaattcct
gcatggtgttcttacgtttttttcgtcattgccacattggtgtttggcctgttcatgggt
ctgatcctggtggtgatttcagaatgtttctgtgtgcctcttccaagagcttcctctgaa
cgctgtgagcaggagcagagtactggagaggctcaaggagctgagcagctacaggatgca
gaggaagaaaaggatgactcaaatgaagaagaaaacaaagacagtcttgtggatgatgag
gaagagaaagaggacattggagatgaggatgaaggagaagaagatgaggaagaggacaac
ttggcaggcatcatggctgaggagagaagtgacaccaacgagcgagcagttgtgaaggag
ggtagtgtgtccccaaaggaggacggagctcacccagctgacactcaggacgtggtggaa
gacgccctgaggcagcgcaagagtcagaatgccaacaagggatcttag

DBGET integrated database retrieval system