KEGG   Mus musculus (mouse): 52855
Entry
52855             CDS       T01002                                 

Gene name
Lair1, 5133400O11Rik, BB115266, D7Bwg0421e, Lair-1
Definition
(RefSeq) leukocyte-associated Ig-like receptor 1
  KO
K06725  leukocyte-associated Ig-like receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    52855 (Lair1)
CD molecules [BR:mmu04090]
 Proteins
  52855 (Lair1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig TMEM52 WBP-1 GpcrRhopsn4 Insulin_TMD Gemini_mov
Other DBs
NCBI-GeneID: 52855
NCBI-ProteinID: NP_001106945
MGI: 105492
Ensembl: ENSMUSG00000055541
Vega: OTTMUSG00000027896
UniProt: Q8BG84
Structure
PDB: 
4ESK 4ETY

Position
7 A1; 7 2.31 cM
AA seq 263 aa
MSLHPVILLVLVLCLGWKINTQEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNM
VRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIK
ENVIQTPAPGPTSDTSWLKTYSIYIFTVVSVIFLLCLSALLFCFLRHRQKKQGLPNNKRQ
QQRPEERLNLATNGLEMTPDIVADDRLPEDRWTETWTPVAGDLQEVTYIQLDHHSLTQRA
VGAVTSQSTDMAESSTYAAIIRH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtcacttcatccagttatcctgctggtgcttgtgctgtgcctgggatggaaaattaac
acacaggagggttctctgcctgatattaccatcttccctaattcaagtcttatgatctcc
caagggacttttgtaactgttgtgtgctcatactctgataaacacgacttgtataacatg
gtccgcctggagaaggacggcagcacctttatggaaaagagcactgagccttataaaaca
gaggatgaatttgagattgggccagtgaatgaaaccattactggacattatagctgtatc
tattcgaaggggattacctggtccgaacgtagtaagacgctggagctaaaggtgatcaaa
gaaaatgtcatccagactcctgccccaggtccaacctcagatacatcttggctaaagaca
tacagcatttacatttttactgtggtctctgtgattttcctcctttgtctttccgccctt
ctgttctgcttcctcaggcaccgtcagaaaaagcagggactcccaaacaacaaaagacag
cagcagaggccagaagagaggctaaatctagctactaatggcctggagatgactccagac
atagttgcagatgacaggcttcctgaggacagatggacagaaacctggaccccagttgca
ggagaccttcaagaggtgacgtatatccagctggaccatcactccctcacacagagggca
gtcggagctgtgacctcacagagcacagatatggctgagtccagcacatatgcagccatc
atcagacactga

DBGET integrated database retrieval system