KEGG   Mus musculus (mouse): 53310
Entry
53310             CDS       T01002                                 

Gene name
Dlg3, Dlgh3, SAP102, mKIAA1232
Definition
(RefSeq) discs large MAGUK scaffold protein 3
  KO
K21098  discs large protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    53310 (Dlg3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53310 (Dlg3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    53310 (Dlg3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    53310 (Dlg3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     53310 (Dlg3)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 MAGUK_N_PEST PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 53310
NCBI-ProteinID: NP_058027
MGI: 1888986
Ensembl: ENSMUSG00000000881
Vega: OTTMUSG00000016499
UniProt: P70175
Position
X; X C3
AA seq 849 aa
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPGWWPECTCTNRDWYEQA
SPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFI
TKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPE
TIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVN
NTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPDYASTFTALADNHISHNS
SLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVG
GEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIV
AQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPS
QGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHA
RTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYAR
PVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQD
NKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSI
EALMEMNRRQTYEQANKIFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHY
IWVPSPEKL
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgcacaagcaccagcactgctgtaagtgccccgagtgctatgaggtgacccgcctggcc
gccctgcggcgtcttgagcctcctggctacggggactggcaggtgccggacccctatggg
ccaagtgggggcaatggggctagctccggttatggaggctacagctcgcagaccctgcct
tcacaggcaggggctacccccacccctcgcaccaaggccaagctcatccccacaggccga
gatgtggggccagtgccccctaagccagtccccggcaagagcaccccaaaactcaacggc
agtggccccggctggtggcccgagtgcacctgtaccaaccgggactggtatgagcaggcc
agccctgcacccctcctagtgaaccccgaggccctggagcccagcctatcggtgaatggc
agtgatggcatgttcaagtatgaggagatagtactggaacggggcaactctggccttggc
ttcagtatcgcaggtggcatcgacaaccctcatgtccctgatgaccctggcatctttatt
accaagatcattcctggtggagcagctgccatggatgggaggctgggggtgaatgactgt
gtgctacgggtgaatgaggtggacgtgtccgaggtggtgcacagccgggccgtggaggca
ctgaaggaggcaggccctgtggtgcggttggtggtgcggaggcgacagcccccacctgag
actatcatggaggtcaacctgctcaaagggccaaaaggcctaggtttcagcattgctggg
ggcattggcaaccagcacatcccaggagacaacagcatctatatcaccaagatcattgaa
ggaggagctgctcagaaggatggacgcctacagattggggaccggctgcttgcggtgaac
aataccaatctgcaggatgtgaggcatgaggaagctgtggcctcactcaagaacacatca
gacatggtctatctgaaggtggccaagccaggcagcatccacctcaacgatatgtatgct
ccccctgactatgccagcactttcactgccttggctgacaatcacataagccataattcc
agcctgggttatcttggggcagtggagagcaaggtcacctaccctgctccacctcaggtg
ccccctactcgttactctcctattcccagacacatgctggctgaggaagactttaccaga
gagccccgcaagatcatcctgcacaaaggttctacaggcctgggcttcaacattgtagga
ggagaagatggagaaggcatttttgtttccttcatcctggcgggaggcccagcagaccta
agtggggagttgcgaaggggagaccggatcttatcggtaaatggagtcaacctgaggaat
gctacccacgagcaagcagcggctgctctgaaacgggctggccagtcagtcaccattgtg
gcccagtatagacctgaagagtacagtcgctttgaatccaagatccatgacttgcgggaa
caaatgatgaacagcagcatgagttctgggtctgggtctctccgaaccagtgagaagagg
tccttgtatgtcagggccctgtttgattatgatcggactcgtgacagctgtctaccaagc
cagggactcagtttctcttatggtgacattctgcacgtcattaacgcctctgatgatgag
tggtggcaagcaaggctggtgactcctcatggagagagtgaacagatcggtgtgatccct
agtaaaaagagggtggaaaagaaagagcgagctcgattgaaaactgtgaagttccatgcc
aggacagggatgattgagtctaatcgggacttccctgggttaagtgacgattattatgga
gcaaagaacctgaagggagtgacatccaacaccagtgacagcgaaagcagttccaaagga
caagaggatgctattttgtcatatgagccagtgacacgacaagaaattcactatgccagg
cctgtgatcatcttgggcccaatgaaggaccgagtcaacgatgacctcatctctgagttc
ccgcataaatttggatcctgtgtgccacataccacccggcctcggcgtgataacgaggta
gatggacaggattaccactttgtggtttcccgggaacaaatggagaaggatattcaggac
aacaagttcattgaggcgggccagttcaatgataatctctatgggaccagcatccagtct
gtgcgggcagttgcagagaggggcaagcactgcatcttagatgtctccggcaacgccata
aagagactgcagcaagcacaactttatcccattgccattttcatcaagcccaagtccatt
gaagcacttatggaaatgaaccgacggcagacatacgaacaagcaaataagatctttgat
aaagccatgaaactggagcaagaatttggagaatactttacagccattgtacagggtgac
tcactggaagagatttataacaaaatcaaacaaatcattgaggaccagtctgggcactac
atttgggtcccatcccctgaaaaactctga

DBGET integrated database retrieval system