KEGG   Mus musculus (mouse): 53317
Entry
53317             CDS       T01002                                 

Gene name
Plrg1, AA958940, C80566, Tango4
Definition
(RefSeq) pleiotropic regulator 1
  KO
K12862  pleiotropic regulator 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    53317 (Plrg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    53317 (Plrg1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    53317 (Plrg1)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    53317 (Plrg1)
 Complex C
   Prp19-CDC5 complex
    53317 (Plrg1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    53317 (Plrg1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nucleoporin_N Nup160
Other DBs
NCBI-GeneID: 53317
NCBI-ProteinID: NP_058064
MGI: 1858197
Ensembl: ENSMUSG00000027998
Vega: OTTMUSG00000029843
UniProt: Q922V4
Position
3; 3 E3
AA seq 513 aa
MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPT
SKENLKEKGPQNATDSYPHKQYPANQGQDVEYLVTGTHPYPAGPGVALTADTKIQRMPSE
SAAQSLAVALPSQTRVDANRTGPAGSEYRHPGASDRSQPTAMNSIMETGNTKNSALMAKK
APTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLS
LTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLD
VLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVA
GKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLAV
NADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAE
ADKTIKVYREDETATEETHPVSWKPEIIKRKRF
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggtggaggaggtacagaagcattctgtacacacactggtgttcaggtcattgaagagg
acccatgacatgtttgtggctgataatggaaaacccgtgcctttggatgaagagagtcac
aagcggaaaatggcaatcaagcttcgcaatgagtatggtcctgtgctgcatatgcctact
tcaaaagagaaccttaaggagaagggacctcagaacgcaacagactcatatcctcataag
cagtatcccgccaaccaaggacaagatgttgagtatttggtgacaggcacccatccatac
ccagcaggacccggtgttgccttgactgctgatactaagatccagagaatgccaagtgag
tcagctgcacagtccctcgctgtggcgttaccgtcccagaccagagttgatgcaaatcgt
actgggcctgctggaagtgagtaccgacacccaggggcttctgaccgttcccagcccaca
gcaatgaattctattatggagaccggcaacactaagaactctgcactaatggcgaaaaaa
gcccctacgatgcccaaaccccagtggcacccaccgtggaaactctacagggttatcagt
gggcatcttggctgggttcggtgtatcgctgtggaacctggaaatcagtggttcgttaca
ggatctgctgacagaaccataaagatttgggacttggctagtggcaaattaaagctgtcg
ttgactggccacatcagtacagtgcgtggtgtgatcgtgagcacgaggagtccttatttg
ttctcttgtggagaagacaaacaagtgaagtgctgggatcttgaatataacaaggtgata
cggcactatcatggccatctaagtgcagtgtatggtctggatttgcacccaacattggat
gtcctggtgacttgtagtcgagattccactgctcggatctgggacgtgagaactaaagcc
agtgtacacactttgtctggacacacaaatgcagttgctaccgtgagatgccaggctgca
gagccacagatcattacaggaagtcacgataccacaatacgattatgggatctagtggct
ggaaagacacgagtgacactgacgaaccataagaaatcagtgagggctgtggtcttacat
ccgctactttacacatttgcgtctggttctccagataacataaagcagtggaaattcccc
gatggaggcttcattcaaaatctctctggtcacaatgcaatcattaacacgctggcggtc
aatgctgatggagtgcttgtgtctggagctgacaatggcaccatgcacctttgggactgg
agaactggctataattttcagcgcgtccatgcagctgtacagcctgggtctttggacagt
gagtcaggaatatttgcttgtgctttcgatcggtcagaaagtcggttactaacggctgaa
gctgataaaaccattaaagtttacagagaggatgagactgcgacagaagaaactcaccca
gtcagctggaaaccagaaattatcaagagaaagcgattttag

DBGET integrated database retrieval system