KEGG   Mus musculus (mouse): 53328Help
Entry
53328             CDS       T01002                                 

Gene name
Pgrmc1, AA415812, HPR6.6, PPMR, Vema, mPR
Definition
(RefSeq) progesterone receptor membrane component 1
  KO
K17278  membrane-associated progesterone receptor component
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    53328 (Pgrmc1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   53328 (Pgrmc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyt-b5 Tr-sialidase_C
Motif
Other DBs
NCBI-GeneID: 53328
NCBI-ProteinID: NP_058063
MGI: 1858305
Ensembl: ENSMUSG00000006373
Vega: OTTMUSG00000017101
UniProt: O55022 Q3TXU8
Position
X; X A3.3
AA seq 195 aa AA seqDB search
MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVY
SDDEEPKDETARKNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggatgtggtggcgactggcgccgacccgagcgagctagagggcggcggg
ctgctgcacgagattttcacgtctcctctcaacctgctcctcctgggcctctgcatcttc
ctgctctacaagatcgttcgcggggaccagcccggtgccagtggcgacaacgacgacgac
gaaccacccccgctgccccgcctcaagcggcgcgacttcacccctgccgagctgaggcgt
ttcgatggcgtccaggacccgcgcattctcatggccatcaacggcaaggtgttcgacgtg
accaaaggccgcaagttctacgggcctgaggggccatatggggtctttgccggaagagat
gcatccaggggccttgccacattttgcctggacaaagaagcactgaaggatgagtatgac
gacctttctgacctcacccctgcacagcaggagaccctgagtgactgggactctcagttc
actttcaagtatcatcacgtgggaaaactgctgaaggaaggggaggagcctactgtgtac
tcagatgatgaagaaccaaaagacgagacagctcggaagaatgaatga

DBGET integrated database retrieval system