KEGG   Mus musculus (mouse): 53378
Entry
53378             CDS       T01002                                 

Gene name
Sdcbp, MDA-, MDA-9, Sy, Sycl, syn, synte, syntenin-1
Definition
(RefSeq) syndecan binding protein
  KO
K17254  syntenin-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    53378 (Sdcbp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   53378 (Sdcbp)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 53378
NCBI-ProteinID: NP_001091697
MGI: 1337026
Ensembl: ENSMUSG00000028249
Vega: OTTMUSG00000004316
UniProt: O08992
Position
4; 4 A1
AA seq 299 aa
MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGL
SLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCK
DQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLK
QAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHIC
EINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtctctttatccatctcttgaagatttgaaggtagacaaagtaattcaggctcaaact
gcttattctgccaatcccgccagccaagcatttgttctggtggatgcttctgctgctctc
cctccagatggaaatctgtatcctaaactgtatccagagctctctcaatacatgggactg
tctttaaatgaagctgaaatatgtgagagcatgcccatggtctctggagcaccagcacaa
gggcagttggtagcaagaccatccagtgtgaactatatggtagcacctgtgacaggtaac
gatgctggaattcggagagcagaaattaagcaagggatccgtgaagttattttgtgtaag
gatcaagatggaaaaattgggctcagacttaagtcaatagataatggtatatttgttcaa
ctcgtccaggctaattccccagcctccttggttggactgagatttggggaccaggtgctc
cagatcaacggtgaaaactgtgcgggctggagctctgataaggcacacaaggtgctcaag
caggcgtttggagagaagatcaccatgacgatccgtgacaggccctttgaacggacagtt
actatgcataaggacagcagtggacatgttggctttatctttaaaagtggaaaaatcaca
tccatagtaaaagatagttctgctgccagaaacggcctcctcactgatcaccacatctgt
gagatcaacggacagaacgtcattggcttgaaggatgctcagattgcagatatactgtca
acagctgggactgtggttaccatcacaatcatgcctacttttatcttcgaacacattatt
aaacggatggctcccagcattatgaaaagcctgatggatcacaccattcctgaagtttaa

DBGET integrated database retrieval system