KEGG   Mus musculus (mouse): 53413Help
Entry
53413             CDS       T01002                                 

Gene name
Exoc7, Exo70, sec70
Definition
(RefSeq) exocyst complex component 7
  KO
K07195  exocyst complex component 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    53413 (Exoc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    53413 (Exoc7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    53413 (Exoc7)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    53413 (Exoc7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    53413 (Exoc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo70 Vps52 Sec34 RolB_RolC COG5
Motif
Other DBs
NCBI-GeneID: 53413
NCBI-ProteinID: NP_058553
MGI: 1859270
Ensembl: ENSMUSG00000020792
Vega: OTTMUSG00000003840
UniProt: O35250 Q3USE0
Structure
PDB: 

Position
11; 11 E2
AA seq 697 aa AA seqDB search
MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTRNMVSILSSFESRLMKLENSI
IPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQ
KAVEYFQDNSPDSPELNKVKLLFERGKESLESEFRSLMTRHSKVVSPVLLLDLISADDEL
EVQEDVVLEHLPESVLRDVVRISRWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFRK
SSSSSGVPYSPAIPNKRKDTPTKKPIKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLE
GRDDMLDVETDAYIHCVSAFVKLAQSEYRLLMEIIPEHHQKKTFDSLIQDALDGLMLEGE
NIVSAARKAIIRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETI
GAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQVLGD
TYNIPLDPRETSSSATSYSSEFSKRLLSTYICKVLGNLQLNLLSKSKVYEDPALSAIFLH
NNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVF
QPGVKLRDKERQMIKERFKGFNDGLEELCKIQKVWAIPDTEQRDKIRQAQKDIVKETYGA
FLHRYGSVPFTKNPEKYIKYRVEQVGDMIDRLFDTSA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgattcccccgcaggaggcttccgcccggcggcgggagatcgaggacaaactgaagcag
gaggaggagacgctgtcgtttatccgagacagcctggagaagagcgaccagctcactagg
aacatggtgtccatcctgtcgtcctttgagagccgactcatgaagctggagaactctatc
atccctgtgcacaagcagacagagaacctacagaggctgcaggagaacgtggagaagacg
ttatcctgcctggaccacgttatcagctactaccacgtagccagcgacacggagaagatc
atccgagagggccccacaggtaggctggaagagtacctgggaagtatggccaaaatccag
aaggctgtggagtattttcaggacaatagcccagacagcccagaactcaacaaagtgaag
ctgctgtttgagcgagggaaggagtccctggagtcggagttccgcagtctgatgacccgg
cacagcaaggtggtctcccccgtgctcctcctggacctcatcagtgctgacgacgagctg
gaggtgcaggaggacgtggtcctggagcacctgcccgagagcgtgctcagagacgtggtc
cgcatctcccgctggctggtggaatatggtcggaaccaagacttcatgaatgtctactac
cagatccgctccagccagctggaccgctccatcaagggtctgaaggagcattttcgcaaa
agcagttcctcttctggggttccctactcccccgccatccccaataagaggaaagacacg
cccaccaagaagcccatcaagcggccagggacgatccgtaaggctcagaaccttctgaaa
cagtattcccagcatggtctagatgggaaaaaggggggctctaacctcattcctctggaa
gggagagacgacatgctggacgtggagacggacgcctacattcactgcgtcagtgccttc
gtcaagctggcgcagagtgaataccggctgctgatggagatcatccctgagcatcaccag
aagaaaacctttgactccttgatacaggatgccctggacgggctgatgcttgaaggggag
aacatcgtgtctgctgccaggaaagccatcatccgccatgacttctccacagtgctcacc
gtcttccccatcctgcggcacctcaagcagaccaagcccgagtttgaccaggtgctccag
ggcacagcagccagcaccaagaacaagctgcccggcctcatcacctccatggagaccatt
ggggccaaagctctagaagactttgctgataacatcaagaatgatccagacaaggaatac
aacatgcctaaagacggcactgttcatgagctcacaagcaatgccatcctgttcctacag
cagcttctggacttccaggagacagcaggtgccatgctggcctcccaagttcttggggac
acatacaatattcctttagacccccgagaaaccagctcttcggccaccagctacagctcc
gagttcagcaagcggctgctgagcacctacatctgcaaagtcttgggtaacctgcagctg
aacttactaagcaagtccaaggtgtacgaggatccagcgctgagcgccatcttcctacac
aacaactacaattacatcctcaagtccctggagaagtctgagctgatccagctggtggct
gtaacccagaagactgccgagcgctcctaccgggagcacatcgagcagcagatccagacc
taccagcgcagctggctaaaggtgactgactacatcgcagagaagaacctacctgtgttc
cagcctggagtcaagctccgggacaaagagcggcagatgattaaggaacgtttcaagggg
ttcaatgatggactcgaagagctgtgcaagattcagaaggtctgggctattccagacaca
gagcagagagacaagattcgacaggctcagaaagacattgtcaaggagacctacggggcc
tttctgcacaggtatggcagcgtgcccttcaccaaaaacccggagaaatacattaagtac
cgcgtggagcaggtgggagacatgatcgatcgccttttcgacacctctgcttga

DBGET integrated database retrieval system