KEGG   Mus musculus (mouse): 53601Help
Entry
53601             CDS       T01002                                 

Gene name
Pcdh12, Pcdh14, VE-cad-2
Definition
(RefSeq) protocadherin 12
  KO
K16499  protocadherin delta 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    53601 (Pcdh12)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   53601 (Pcdh12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_3 DUF5527
Motif
Other DBs
NCBI-GeneID: 53601
NCBI-ProteinID: NP_059074
MGI: 1855700
Ensembl: ENSMUSG00000024440
Vega: OTTMUSG00000050571
UniProt: O55134 Q8C883
Position
18; 18 B3
AA seq 1180 aa AA seqDB search
MMLLLPFLLGLLGPGSYLFISGDCQEVATVMVKFQVTEEVPSGTVIGKLSQELRVEERRG
KAGDAFQILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPCLVSFDVLATGASALIH
VEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQDTGPNSLYSYSLSPSEHF
ALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAYDNGNPPKSGISVVKVNVLDSNDN
SPVFAESSLALEIPEDTVPGTLLINLTATDPDQGPNGEVEFFFGKHVSPEVMNTFGIDAK
TGQIILRQALDYEKNPAYEVDVQARDLGPNSIPGHCKVLIKVLDVNDNAPSILITWASQT
SLVSEDLPRDSFIALVSANDLDSGNNGLVHCWLNQELGHFRLKRTNGNTYMLLTNATLDR
EQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAPVFEKSRYEVSTWENNPPSLHLI
TLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEVTAQRSLDYEQMAGFEFQVIAEDR
GQPQLASSISVWVSLLDANDNAPEVIQPVLSEGKATLSVLVNASTGHLLLPIENPSGMDP
AGTGIPPKATHSPWSFLLLTIVARDADSGANGELFYSIQSGNDAHLFFLSPSLGQLFINV
TNASSLIGSQWDLGIVVEDQGSPSLQTQVSLKVVFVTSVDHLRDSAHEPGVLSTPALALI
CLAVLLAIFGLLLALFVSICRTERKDNRAYNCREAESSYRHQPKRPQKHIQKADIHLVPV
LRAHENETDEVRPSHKDTSKETLMEAGWDSCLQAPFHLTPTLYRTLRNQGNQGELAESQE
VLQDTFNFLFNHPRQRNASRENLNLPESPPAVRQPLLRPLKVPGSPIARATGDQDKEEAP
QSPPASSATLRRQRNFNGKVSPRGESGPHQILRSLVRLSVAAFAERNPVEEPAGDSPPVQ
QISQLLSLLHQGQFQPKPNHRGNKYLAKPGGSSRGTIPDTEGLVGLKPSGQAEPDLEEGP
PSPEEDLSVKRLLEEELSSLLDPNTGLALDKLSPPDPAWMARLSLPLTTNYRDNLSSPDA
TTSEEPRTFQTFGKTVGPGPELSPTGTRLASTFVSEMSSLLEMLLGQHTVPVEAASAALR
RLSVCGRTLSLDLATSGASASEAQGRKKAAESRLGCGRNL
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacttctgccattcctgctagggctcttagggccaggaagctacttgttcatt
tcaggggattgtcaggaggtggccactgtcatggtgaaattccaagtgacagaggaagtg
ccgtctggcacggtgatagggaaactgtcccaagaactaagagtggaggagaggcgtggg
aaggcaggagatgccttccagattctgcagctgcctcaggcactgccggttcagatgaac
tctgaggacggcctgctcagcacttccagccggctggatcgggagaagctatgtcggcag
gaagatccctgtctggtgtcatttgacgtgcttgccacaggggcgtctgctctaattcat
gtggagattcaggtgctagacatcaatgaccaccagccacagtttcccaaagacgagcag
gaactggaaatctcagagagtgcctctctgcacacacgaatccccttggacagagctctt
gaccaagacacgggtcctaacagcttatattcctactccctgtctcccagtgaacacttt
gccctggatgttattgtgggccctgatgagaccaaacatgcagagcttgtggtggtgaag
gagttggacagggaactccactcatattttgatctggtgctgaccgcctatgacaatggg
aatccccctaagtcaggaatcagcgtggtcaaggtcaatgtcctggactccaatgacaat
agtccagtgtttgctgagagttcactagcactagaaatcccagaagacactgttcctggt
actcttctcataaacctgactgctacagatcccgaccaaggacccaatggggaggtagag
ttcttctttggcaagcatgtgtccccagaggtgatgaacacctttggcatagatgccaag
acaggccagatcattctgcgccaagccctagattacgagaagaaccctgcctatgaggtg
gatgtccaggcaagggatttgggtcccaattccatcccaggccattgcaaagttcttatc
aaagttctggatgtcaatgacaatgccccaagcatcctcatcacgtgggcctcccagacg
tcgctggtgtcagaagatcttcccagggatagcttcattgcccttgtcagtgcgaatgac
ttggactcaggaaacaacggtctcgtccactgttggctgaatcaagagctgggccacttc
agactgaaaaggactaacggcaacacgtacatgctgctcaccaatgccacactggacaga
gagcagtggcccatatatactctcactgtgtttgcccaagaccaaggaccccagccctta
tcagctgagaaggagctccaaattcaggttagtgatgtcaatgacaatgcccctgtgttt
gagaagagccggtacgaggtctccacttgggaaaataacccaccctctcttcacctcatc
acgctcaaagcgcatgatgctgacttgggcagtaatggaaaagtgtcataccgtatcaag
gactcccccgtttctcacttagtcattattgactttgaaacaggagaagtcactgctcag
aggtcactggactatgaacagatggcaggctttgagttccaggtgatagcagaggacaga
gggcaaccccagctcgcatccagcatctcggtgtgggttagcctcttggatgccaatgat
aatgccccagaagtgattcagcctgtgctcagtgaaggcaaagccaccctttcggtgctt
gtaaatgcctccacgggccaccttctgttgcccattgagaatcccagtggcatggatcca
gcaggtactggtataccaccaaaggctacccacagcccctggtctttccttttgttaaca
atcgtggctagggatgcagactcgggggccaatggggaactcttctacagcattcaaagt
gggaatgatgctcatctctttttcctcagcccttccttggggcagctattcattaatgtc
accaatgccagcagcctcatcgggagtcagtgggacctggggatagtggtagaggaccag
ggcagcccctccttgcagacccaagtttcattgaaggtcgtgtttgtcaccagtgtggac
cacctaagggattctgctcatgagcccggagttctgagcacaccagcactggctttgatc
tgcctggctgtactgctggccatctttggattgctcttagccctgttcgtgtccatctgc
aggacagagagaaaggataatagggcctacaactgtcgagaagctgagtcgtcataccgc
caccagcccaagaggccccagaaacacattcagaaggcagatatccacctggtgcctgtg
cttagggcccacgagaatgagactgatgaagtcaggccatctcacaaggataccagcaag
gagacactgatggaggcaggctgggactcttgcctgcaggcccccttccacctcacacca
accctatacaggaccctgcgtaaccaaggcaaccagggagaactggcagagagccaggag
gtactgcaggacaccttcaactttctctttaaccatcccaggcagaggaatgcctcccgg
gagaacctaaaccttcctgagtccccacctgctgtacgccaaccactcttaaggcctctg
aaggtgcctggtagccccatagcgagggcgactggagaccaagacaaggaggaggcccca
cagagcccaccagcgtcctctgcaaccctaagacgacagcggaatttcaatggcaaagtg
tctcctagaggagagtccggtcctcatcagattctgaggagcctggttaggctctctgtg
gctgcttttgcggaacggaacccggtggaggagcctgctggggactctcctcctgtccag
caaatctcccagctgctgtccttgctgcaccagggccaattccagcccaaaccaaaccac
cgaggaaataaatacttggccaagcccggcggcagcagcaggggtaccatcccagacaca
gagggccttgtaggcctcaagcctagtggtcaagcagaacctgacctggaagaagggccc
ccgagcccggaggaggacctttctgtaaagcgacttctagaagaagagctgtcgagcctg
ttggaccctaatacaggtctagccctggacaagctgagtccgcctgacccagcctggatg
gcgagattgtcattgcccctcaccaccaattaccgagacaacttgtcttcccccgatgct
acaacgtcagaggaaccgagaaccttccagacattcggcaagacagttggaccgggaccc
gagctgagcccaacaggcacgcgcctggccagcactttcgtctcggagatgagctctctg
ctggaaatgttgttggggcagcacacggtaccagtggaagctgcgtccgcggctttgcgg
aggctctcggtgtgcgggaggaccctcagtctagacctagccaccagtggggcctcagct
tcagaagcacagggtagaaagaaggcagctgagagcagacttggctgtggcaggaatcta
tga

DBGET integrated database retrieval system