KEGG   Mus musculus (mouse): 53604Help
Entry
53604             CDS       T01002                                 

Gene name
Zpbp, 4930486K01Rik, Iam38, Sp38
Definition
(RefSeq) zona pellucida binding protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Sp38 Ig_3 ig I-set LuxQ-periplasm
Motif
Other DBs
NCBI-GeneID: 53604
NCBI-ProteinID: NP_056600
MGI: 1855701
Ensembl: ENSMUSG00000020193
Vega: OTTMUSG00000007679
UniProt: Q62522 Q5NC84
Position
11; 11 A1
AA seq 408 aa AA seqDB search
MCTQAGSQASTPPAHHPSGSGASVGPSFRPAVCQLPAAGGRAPGNDLLRRGSAVGGVWME
ALAPGRAPRGRRRAGASGSVLSPLSLAAVLLCALLRAPPAVGHLARLPRSIHLTQDSLKI
VGSTHFPVSVYVMLHQKSPHVLCVTQRLRNTELVDPSFQWHGPKGKLVSENTTAQVTSTG
SLIFQSFEETMSGVYTCFLEYKPTVEESIKNLQLKYIVYAYREPRFYYQFTARYHAAPCN
SIYNISFEKKLLQILSKLVLDLSCEISLIKSECHRVKMQRAGLQNELFFTFSVASIDTEK
GSKPCTDHSCEASKRLSKAKNLIERFFIQQVEVLGKRAEPLPEIYYIEGTLQMVWVNRCF
PGYGINVLKHPKCPECCVVCSPGSFNPRDGTHCLQCNNSLVYGAKTCM
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacccaagctgggtcccaagctagcacacctcccgcacatcacccgagcggaagt
ggcgcgtccgtcggtccgtccttccggcctgccgtctgccaacttccggcggcgggtggg
cgcgcgccaggtaacgaccttctgcgccgaggctcggccgtcggcggcgtgtggatggag
gccttggccccgggccgggctccgcggggccggcggcgggccggggcctcgggctccgtg
ctctcgccgctgtcgctggccgccgtcctgctctgcgccttgctgcgggcgccccctgca
gttggacatttggctcgactgccaagaagtatccacttgactcaagattcactgaaaata
gtgggatcgacacattttcctgtgagcgtatatgttatgcttcatcaaaagagtccacat
gtgctatgtgtaacccaacgactgagaaatacagagctggtagacccatcattccaatgg
catgggccaaaaggaaaacttgtttcagaaaataccactgcacaagtgacctccacagga
agcctcatatttcagagctttgaagagaccatgagtggggtttatacatgtttcctcgag
tataaaccaactgtagaggaatctattaaaaatcttcaactgaaatacattgtttatgct
tatcgtgaacctcggttttattatcagttcacagctcgataccatgcagctccctgcaac
agtatctataacatttcttttgagaagaaacttcttcagattttaagtaagctggttctt
gacctttcctgtgaaatatccttgattaagtctgaatgccatcgtgttaaaatgcaaaga
gctggtttgcaaaatgaattgttcttcacattttcagttgcatctatagacacagaaaaa
ggatccaagccatgtacagaccatagttgtgaagcttccaaaagattatctaaggctaaa
aatctcatagagagattcttcattcagcaagtagaagtcctgggcaagcgtgcggagcca
ctgcctgagatatactacattgagggaacccttcagatggtgtgggtgaaccgctgcttt
ccagggtatggcataaatgtcctgaagcatcccaagtgcccagagtgctgtgtggtctgc
agccctggatccttcaatccccgggatggaactcattgcctccagtgcaacaacagcctg
gtgtatggagcgaagacatgcatgtag

DBGET integrated database retrieval system