KEGG   Mus musculus (house mouse): 53610
Entry
53610             CDS       T01002                                 
Symbol
Nono, NRB54, P54NRB, nonA
Name
(RefSeq) non-POU-domain-containing, octamer binding protein
  KO
K13214  non-POU domain-containing octamer-binding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    53610 (Nono)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    53610 (Nono)
SSDB
Motif
Pfam: RRM_1 NOPS RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 53610
NCBI-ProteinID: NP_001239447
MGI: 1855692
Ensembl: ENSMUSG00000031311
UniProt: Q99K48 Q4FK11
Structure
Position
X:100473080..100492199
AA seq 473 aa
MQSNKAFNLEKQNHTPRKHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTID
LKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLET
RTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAV
VIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPE
KLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEM
EMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQ
QEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPAT
MMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcagagcaataaagcctttaacttggagaagcagaatcatactccaaggaagcatcat
cagcatcaccaccagcagcaccatcagcagcaacagcagcagcagcagcaacagccaccc
ccaccaatacctgcaaatggccagcaggccagcagccagaatgaaggcttgactattgac
ctgaagaattttaggaaaccaggagagaagacctttacacagcgtagccgtctctttgtg
ggcaatcttccccctgatatcactgaggaggaaatgaggaaactatttgagaaatatgga
aaagcaggcgaagttttcattcataaggataaaggctttggctttattcgcttggaaaca
cgaaccctagcggaaattgccaaagtggagctggacaacatgcccctccgtgggaagcag
ctgcgagtgcgctttgcctgtcacagtgcatcccttacagtccgcaaccttcctcagtac
gtgtcgaacgaactgctggaagaagccttttctgtgttcggccaggtggagagggctgta
gtcattgtggatgaccgaggaaggccctcagggaaaggcattgttgagttctcagggaag
ccagctgctcggaaagctctggacagatgcagtgaaggctccttcttgctgactacattt
cctcggcctgtgactgtggagcctatggaccagttagatgatgaagagggacttccagag
aaactggttataaaaaaccagcaattccacaaggagagagaacagccacccagatttgca
caacctggctcctttgagtatgagtatgccatgcgctggaaggcactcattgagatggag
aagcaacagcaggatcaagtggatcggaacatcaaggaggctcgtgagaagctggagatg
gagatggaggctgcacgtcatgagcaccaggttatgctaatgaggcaggatttgatgaga
cgtcaagaagagcttcggagaatggaggagctgcataaccaagaggttcagaagcgaaag
cagttagaactcaggcaggaagaggaacgcaggcgccgtgaggaagagatgcggcgacag
caagaggaaatgatgcgccgacagcaggaaggattcaagggaaccttccctgatgcgaga
gaacaagagatacggatgggccaaatggctatgggaggtgctatgggcataaacaataga
ggcgcgatgccccctgctcctgtgccacctggtactccagctcctccaggacctgccact
atgatgccagatggaacccttggattgaccccaccaacaactgaacgttttggccaagct
gcaacaatggaaggaattggagcaattggtggaactcctcctgcattcaaccgtccagct
ccgggagctgaatttgctccaaataaacgccgccgatattag

DBGET integrated database retrieval system