KEGG   Mus musculus (mouse): 53622
Entry
53622             CDS       T01002                                 

Symbol
Krt85, AA589597, BB007925, Hb5, Krt2-18
Name
(RefSeq) keratin 85
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    53622 (Krt85)
   04147 Exosome [BR:mmu04147]
    53622 (Krt85)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     53622 (Krt85)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   53622 (Krt85)
  Exosomal proteins of other body fluids (saliva and urine)
   53622 (Krt85)
  Exosomal proteins of colorectal cancer cells
   53622 (Krt85)
  Exosomal proteins of bladder cancer cells
   53622 (Krt85)
SSDB
Motif
Pfam: Filament Keratin_2_head BAT TPR_MLP1_2 CALCOCO1 DUF4924 Nuf2_DHR10-like DUF885 Crescentin CATRA-C
Other DBs
NCBI-GeneID: 53622
NCBI-ProteinID: NP_058575
MGI: 1859268
Ensembl: ENSMUSG00000116336
UniProt: Q9Z2T6
Position
15:complement(101413569..101422054)
AA seq 507 aa
MSCRSYRISPGCGVTRNFSSCSAVAPKTGNRCCISAAPFRGVSCYRGLTGFSSRSLCNPS
PCGPRMAVGGFRSGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVK
YEEKEQIKCLNSKFAAFIDKVRFLEQQNKLLETKWQFYQNRKCCESNLEPLFGGYIEALR
REAECVEADSGRLAAELNHVQEAMEGYKKKYEEEVALRATAENEFVVLKKDVDCAYLRKS
DLEANVEALVEESSFLKRLYEEEVCVLQAHISDTSVIVKMDNSRDLNMDCVVAEIKAQYD
DVASRSRAEAESWYRTKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEIENAKCQR
AKLEAAVAEAEQQGEAALADARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLALDIEI
ATYRRLLEGEEQRLCEGVGSVNVCVSSSRGGVTCGGLTYGTTPGRQIVSGPSVTGGSITV
MAPDSCSPCQPRASSFTCGSSRSVRFA
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtcctgtcgctcctacaggatcagcccaggatgtggagttaccagaaacttcagctcc
tgctcagccgtagcccccaaaactggcaaccgctgctgcatcagcgcagctcccttccga
ggagtgtcttgctaccggggattgactggcttcagcagccgaagcctctgtaacccaagc
ccctgtgggccccgcatggctgttgggggcttccgctctggctcctgtggacgcagcttc
ggataccgttctggaggcgtctgtgggcccagcccgccctgcatcaccaccgtctctgtc
aatgagagcctgctcacgcccctgaacctggagatcgaccccaatgctcagtgtgtgaag
tatgaagagaaggagcagatcaagtgtctcaacagcaagttcgcggccttcattgacaag
gtgcgattcctggagcaacagaacaagctgctggagaccaagtggcagttctaccagaac
cgcaagtgctgtgagagcaacctggagcccctgtttggaggctacatcgaggcactgagg
cgggaggctgaatgtgtggaggcggacagcgggaggctggctgctgagctcaaccatgtg
caggaggccatggagggctacaagaaaaagtatgaagaggaggtggctctgagggctaca
gcagagaatgagtttgtggtactaaagaaggatgtggactgtgcctacttacgtaaatca
gacctggaggccaacgtggaggccttggtggaggagtcaagcttcctgaagcgtctttat
gaagaggaggtctgtgttctgcaagcccacatctcagacacctctgtcatcgtcaagatg
gacaacagccgagacctgaacatggactgcgtcgtggctgagatcaaggctcagtatgat
gacgttgccagccgcagccgtgctgaggctgagtcctggtaccgcaccaagtgtgaggag
atgaaggccaccgtgatccggcatggggagaccctgcgccgcacgaaggaggagatcaac
gagctgaacagaatgatacagaggctgaccgccgagatcgagaatgccaagtgccagcgt
gccaagctggaagctgctgtggctgaggcagagcagcagggagaggccgccctcgctgat
gcccgctgcaagctggctgagctggagggtgccctgcagaaggccaagcaggacatggcc
tgcctgctcaaggagtaccaggaggtaatgaactccaagctggcactggacatcgagatc
gccacctacaggcgcctgctggagggcgaggagcagaggctctgcgagggtgtgggctct
gtgaatgtctgtgtcagcagctcccgtggaggagtcacatgtgggggcctcacctatggc
acaaccccagggcgccagattgtctctggaccctctgtcactgggggcagcatcacagtg
atggcccctgactcctgctctccttgccagccccgcgcctccagctttacctgtgggagc
agccgctcagtgcgcttcgcttag

DBGET integrated database retrieval system