KEGG   Mus musculus (house mouse): 53625
Entry
53625             CDS       T01002                                 
Symbol
B3gnt2, AA408337, AA409404, AW260308, B3Galt6, B3gnt1, BGnT-1, BGnT-2, BGnT1, BGnT2, Beta3gnt
Name
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
  KO
K00741  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.149]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00533  Glycosaminoglycan biosynthesis - keratan sulfate
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    53625 (B3gnt2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    53625 (B3gnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    53625 (B3gnt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     53625 (B3gnt2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   53625 (B3gnt2)
SSDB
Motif
Pfam: Galactosyl_T Fringe DUF604
Other DBs
NCBI-GeneID: 53625
NCBI-ProteinID: NP_001162585
MGI: 1889505
Ensembl: ENSMUSG00000051650
UniProt: Q9Z222 Q3TVJ9
Position
11:complement(22784739..22810336)
AA seq 397 aa
MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKFWKPPSTPRAYWN
REQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDRFKDFL
LYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVF
LLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEF
VFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVY
PPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEE
KNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtgtggggcgtcgaagagtcaagttgctgggcatcctgatgatggcaaatgtcttc
atttatttgattgtggaagtctccaaaaacagtagccaagacaaaaatggaaagggagga
gtaataatcccgaaagagaagttctggaagccacccagcactccccgggcatactggaac
agggaacaggagaagctgaacaggtggtacaatcccatcttgaacagggtggccaatcag
acaggggagctagccacatctccaaacacaagtcacctgagctattgtgaaccagactcg
acggtcatgacagctgtgacagattttaataatctgccggacagatttaaagactttctc
ttgtatttgagatgccggaattactcgctgcttatagatcaaccgaagaaatgtgcaaag
aagcccttcttactattggcgataaagtccctcattccacattttgccagaaggcaagca
attcgggagtcttggggccgagaaaccaacgtagggaaccagacagtagtgagggtcttc
ctgttgggcaagacacccccagaggacaaccaccctgacctttcggacatgcttaagttt
gagagtgacaagcaccaggacatcctcatgtggaactatagagacacattcttcaacctg
tccctgaaggaagtgctgtttcttaggtgggtgagcacttcctgtccagacgcagagttt
gtcttcaagggcgatgatgacgtgtttgtgaacacccatcacatccttaattacttgaat
agcttatccaagagcaaagccaaagacttgttcataggtgacgtgatccacaatgctggg
cctcaccgggataagaaactgaagtactacatcccagaagtcttctacaccggcgtctac
ccaccgtatgccgggggtggtggattcctgtactccggcccccttgccttgaggctgtac
agtgcgactagccgggtccatctctaccctattgatgatgtttatacgggaatgtgcctt
cagaaactgggccttgttccagagaagcacaaaggcttcaggacatttgatattgaagag
aaaaataagaaaaatatttgttcctatatagacctaatgttagtacatagcagaaaacct
caagagatgattgatatctggtctcagttgcaaagtcctaatttaaaatgctga

DBGET integrated database retrieval system