KEGG   Mus musculus (mouse): 53791
Entry
53791             CDS       T01002                                 

Gene name
Tlr5
Definition
(RefSeq) toll-like receptor 5
  KO
K10168  toll-like receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    53791 (Tlr5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    53791 (Tlr5)
   05134 Legionellosis
    53791 (Tlr5)
  09163 Immune disease
   05321 Inflammatory bowel disease
    53791 (Tlr5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    53791 (Tlr5)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   53791 (Tlr5)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 LRR_5 TIR_2 LRR_9 LRR_1 CoV_E
Other DBs
NCBI-GeneID: 53791
NCBI-ProteinID: NP_058624
MGI: 1858171
Ensembl: ENSMUSG00000079164
Vega: OTTMUSG00000050487
UniProt: Q9JLF7 Q05AH3 E9QL10 Q8CB40
Position
1 H5; 1 86.12 cM
AA seq 859 aa
MACQLDLLIGVIFMASPVLVISPCSSDGRIAFFRGCNLTQIPWILNTTTERLLLSFNYIS
MVVATSFPLLERLQLLELGTQYANLTIGPGAFRNLPNLRILDLGQSQIEVLNRDAFQGLP
HLLELRLFSCGLSSAVLSDGYFRNLYSLARLDLSGNQIHSLRLHSSFRELNSLSDVNFAF
NQIFTICEDELEPLQGKTLSFFGLKLTKLFSRVSVGWETCRNPFRGVRLETLDLSENGWT
VDITRNFSNIIQGSQISSLILKHHIMGPGFGFQNIRDPDQSTFASLARSSVLQLDLSHGF
IFSLNPRLFGTLKDLKMLNLAFNKINKIGENAFYGLDSLQVLNLSYNLLGELYNSNFYGL
PRVAYVDLQRNHIGIIQDQTFRLLKTLQTLDLRDNALKAIGFIPSIQMVLLGGNKLVHLP
HIHFTANFLELSENRLENLSDLYFLLRVPQLQFLILNQNRLSSCKAAHTPSENPSLEQLF
LTENMLQLAWETGLCWDVFQGLSRLQILYLSNNYLNFLPPGIFNDLVALRMLSLSANKLT
VLSPGSLPANLEILDISRNQLFSPDPALFSSLRVLDITHNEFVCNCELSTFISWLNQTNV
TLFGSPADVYCMYPNSLLGGSLYNISTEDCDEEEAMRSLKFSLFILCTVTLTLFLVITLV
VIKFRGICFLCYKTIQKLVFKDKVWSLEPGAYRYDAYFCFSSKDFEWAQNALLKHLDAHY
SSRNRLRLCFEERDFIPGENHISNIQAAVWGSRKTVCLVSRHFLKDGWCLEAFRYAQSRS
LSDLKSILIVVVVGSLSQYQLMRHETIRGFLQKQQYLRWPEDLQDVGWFLDKLSGCILKE
EKGKKRSSSIQLRTIATIS
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggcatgtcaacttgacttgctcataggtgtgatcttcatggccagccccgtgttggta
atatctccctgttcttcagacggcaggatagcctttttccgaggctgtaacctcacccag
attccctggatcctcaatactaccactgagaggctcctgctcagcttcaactatatcagt
atggtggttgccacatcatttccactcctggagcggctccagttgctggagctggggacc
cagtatgctaacttgaccattggtccaggggctttcagaaacctgcccaatcttaggatc
ttggacttgggccaaagccagatcgaagtcttgaatcgagatgcctttcaaggtctgccc
catctcttggaacttcggctgttttcctgtggactctccagtgctgtgttaagtgacggt
tacttcagaaatctatattcattagctcgcttagacctatctggcaaccagattcacagc
ctccgcctccattcttcattccgggaactgaattccttaagcgacgtaaattttgctttc
aaccaaatattcactatatgtgaagatgaactcgagcctctgcagggcaaaacactgtct
ttctttggcctcaaattaactaagctgttcagcagagtctctgtgggctgggagacatgc
aggaaccccttcagaggcgtgaggctagaaactctagatctttctgaaaatggctggacg
gtggacatcacaaggaacttcagcaacatcatccagggaagccagatttcctctttgatt
cttaaacaccacatcatgggtcctggctttggcttccagaacatcagagatcctgaccag
agcacatttgccagcctggccagaagttcggtgctgcaactggacctttcgcacggcttt
atcttctccttgaatcctcgactgtttgggacactgaaggatttgaagatgctgaacctt
gccttcaacaagataaacaagattggagagaatgccttttatgggcttgacagcctccag
gttctcaatctatcctataatcttttgggggaactctataattccaacttctatgggctt
cctagagtagcctacgttgaccttcaaaggaaccacattgggatcattcaagaccaaaca
ttcagattattaaaaacgttacaaaccttagatctccgtgacaatgctcttaaggccatt
ggttttattccaagcatacagatggtcctcctgggaggcaataagctggtccatttgcca
cacatccactttactgccaacttcctagagttatctgaaaacaggctagaaaacctgtcc
gacctctacttcctcctgcgagtcccccagctccagtttctcatcttgaatcagaatcgc
ctttcgtcatgcaaggcagcccacactccctcggagaacccaagcttagaacagcttttc
cttacagagaatatgctgcagctggcctgggagaccggcctctgttgggatgtttttcaa
ggcctttcccgcctccagattctttacctgagtaataactaccttaatttccttccacct
gggatatttaacgacctggttgcattacggatgcttagtcttagtgctaacaagctgacc
gtgctctctccgggcagtttacctgctaatttagagattctcgacatatctagaaatcag
cttttctctcctgaccctgctttgttttcttcgcttcgtgttttggacataactcataac
gagttcgtctgcaactgtgaacttagcacttttatctcctggctcaaccaaaccaacgtc
accctgttcggctctcctgcagacgtgtattgcatgtaccctaactcactgctagggggc
tccctctacaacatatccaccgaagactgcgatgaagaggaagccatgcggtccctaaag
ttttcccttttcatcctgtgcacggtcactttgactctattcctcgtcatcacccttgta
gtcataaagttccggggaatctgtttcctgtgctataagaccatccagaagctggtgttc
aaggacaaggtctggagtttggaacctggtgcatatagatatgatgcctacttctgcttc
agcagcaaagactttgaatgggcacagaatgctttgctcaaacacctggatgctcactac
agttcccgaaacaggctcaggctatgctttgaagaaagagacttcattccgggggaaaac
catatctccaacatccaggcggctgtctggggcagcaggaagacggtgtgtctagtgagc
agacacttcctgaaggatggttggtgcctggaggccttcaggtatgcccagagccggagt
ctgtctgacctcaagagcattctcatcgtggtggtggtgggatcgctgtcccagtatcag
ctgatgagacatgagaccatcagagggtttctgcaaaagcaacagtacttgaggtggcct
gaagacctccaggatgttggctggtttctcgataaactctccggatgcattctaaaggaa
gaaaaaggaaagaaaagaagcagttccatccagttgcgaaccatagcaaccatttcctag

DBGET integrated database retrieval system