KEGG   Mus musculus (mouse): 53867
Entry
53867             CDS       T01002                                 

Gene name
Col5a3
Definition
(RefSeq) collagen, type V, alpha 3
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    53867 (Col5a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    53867 (Col5a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   53867 (Col5a3)
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Other DBs
NCBI-GeneID: 53867
NCBI-ProteinID: NP_001304317
MGI: 1858212
Ensembl: ENSMUSG00000004098
Vega: OTTMUSG00000022343
UniProt: Q9JLI2
Position
9; 9 A3
AA seq 1738 aa
MRSCRRLDQLQAGLCLLLASLQLVSWTLAEPVDVLEAWGVHRDQAGVAEGPGFCPLRIPQ
GDRAFRVGKSSLLSVPTWQLFPDGHFPENFSVLLTLRAQPANQSVLLSIYDEKGVRQLGL
ALGPALGLLGDSFRPLPKQVNIMDGRWHRVAVSISGNKVTLVVDCEPQPPTFGQGPRFIS
TAGLTVMGTQDTREESFEGDIQELLLIPDPQAAFQACESYLPGCETLDSTTTGAPKDDEP
ETPAPRRRKGKGKKKGRGRKGKGRKKNKETSELSPTPGAPENQTSLHIPETEKTVPHLPL
TPTPLAITTTVTIGQNATVSQGLDSGTETEQTTPEVDSTEEGEGGGPTMGPKFRAAEQSL
QTEFQIFPGAGEKGAKGEPATVEQGQQFEGPAGAPGPRGISGPSGPPGPPGFPGDRGLPG
PAGLPGIPGIDGARGLPGTVIMMPFHFASSSMKGPPVSFQQAQAQAVLQQAQLSMKGPPG
PVGLTGRPGPVGLPGYPGLKGELGEVGPQGPRGLQGPPGPPGREGKTGRAGADGARGLPG
DTGPKGDRGFDGLPGLPGEKGQRGDFGRVGQPGPPGEDGVKGLQGPPGPTGQAGEPGPRG
LIGPRGLPGPLGRPGVTGSDGAPGAKGNVGPPGEPGPPGQQGNHGSQGIPGPQGPIGTPG
EKGPPGNPGIPGVPGSEGPPGHPGHEGPTGEKGAQGPPGSAGPRGYPGLRGVKGTSGNRG
LQGEKGERGEDGFPGFKGDEGPKGDRGNPGPPGPRGEDGPEGQKGPGGLPGDEGPPGAAG
EKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPLGEKGKRGKAGQPGEEGERGTPGTRGDRG
QPGATGQPGPKGDVGQNGSPGPPGEKGLPGLQGPPGFPGPKGPPGPQGKDGISGHPGQRG
ELGFQGLTGPPGPAGVLGPQGKVGDVGPLGERGPPGPPGPPGEQGLPGIEGREGAKGELG
PLGSVGKEGPPGPRGFPGPQGAPGDPGPIGLKGDKGPPGPVGANGSPGERGPVGPSGGIG
LPGQSGGQGPIGPAGEKGSPGERGTPGPTGKDGIPGPPGLQGPSGAAGPSGEEGDKGEVG
MPGHKGSKGDKGDAGPPGPTGIRGPAGHSGLPGADGAQGRRGPPGLFGQKGDDGVRGFVG
VIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPPGPSGSEGPPGLPGGVGQPGAVG
EKGEPGDAGDAGPPGIPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGSKGNMGPTG
LPGDLGPPGDPGVPGIDGIPGEKGNAGDIGGPGPPGASGEPGARGLPGKRGSPGRMGPEG
REGEKGAKGDAGPDGPPGRTGPIGARGPPGRIGPDGLPGIPGPVGEPGLLGPPGLIGPPG
PLGPPGLPGLKGDAGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGLQGDPGLPG
PVGSLGHPGPPGVVGPLGQKGSKGSPGSLGPRGDPGPAGPPGPPGSPAEVHGLRRRRSVT
DTLEGGLEEVMASLNSLSLELQQLQRPLGTAESPGLMCRELHRDHPHLPDGEYWIDPNQG
CARDAFKVFCNFTAGGETCLYPDKKFETVKLASWSREKPGGWYSTFRRGKKFSYVDADGS
PVNVVQLTFLKLLSAAAHQRFTYICQNSVAWLDEAAGDHRHSIRFQGTNWEELSFNQTTA
ATIKVSHDGCRVRKGQAKTLFEFSSSVGFLPLWDVAASDFGQTNQKFGFELGSICFSS
NT seq 5217 nt   +upstreamnt  +downstreamnt
atgagaagctgccggagactggatcagcttcaggccggcctctgcctgctcctggcctcc
ctgcagctcgtgtcctggacgctggctgaacctgtggacgtactggaagcctggggtgtg
catagagaccaggctggggtggctgaagggcctggcttctgccccctgaggattccacag
ggtgaccgagcattcagggtgggcaagtccagccttctcagtgtccccacgtggcagctc
ttcccagatgggcattttcctgagaacttttctgtgctgctcacactgagggcccagcca
gccaatcagtctgtccttctgtctatttatgatgagaagggtgtccggcagctggggctg
gcactggggccagctctgggcctccttggtgactccttcaggcccctccccaagcaagtc
aacattatggatggcaggtggcaccgtgtggcagtcagcatcagtggtaacaaggtgacc
ctggtggttgactgtgaaccgcagcccccaacatttggtcaggggcctcggtttataagt
acagctggactcactgtgatgggaacccaggacaccagggaagagtcttttgagggagac
atccaggagctgctgttaattccagaccctcaggctgccttccaggcctgtgagagctac
ctccctggttgtgaaaccctcgattccacaaccacaggggcccccaaagacgatgaacca
gaaacccctgcccctcgtcgtcgaaagggcaaagggaagaaaaaagggcggggtcgaaag
ggcaagggaagaaagaaaaacaaggagacctcagagctgagtccgacccctggtgcccct
gagaaccagacctccctccacatccctgagacagagaagacagttccccacctgcctctg
actcccacacctctggccatcaccaccactgtcacgattggacaaaatgccacagtctcg
caggggttggactccggtactgaaaccgagcagacgactccagaggtggactctactgag
gagggtgaaggaggtggccccaccatgggccccaagttccgggcagcagagcagtcctta
cagactgagttccagatctttcctggtgctggagaaaagggagcgaaaggagagcctgcg
acagtagagcagggacagcagtttgaggggcctgcaggagctccaggaccccggggaata
tctggtccttcaggccctcctgggcctccgggcttccctggggaccgtggtctaccgggt
cctgccggcctcccaggaatcccaggcatcgatggagcccggggcctgccgggcacagtg
attatgatgccgttccattttgcaagcagctcgatgaagggacccccagtgtccttccag
caggcccaggcccaggcagtattgcaacaggctcagctgtccatgaaagggccccctggt
ccagtagggctcactgggcgcccaggccctgtgggcctccctggatatccaggtctgaaa
ggtgaactgggagaagtggggccacagggcccccgaggattacagggccctcctgggcct
cctggacgggaaggcaagacaggccgagctggagcagatggggctcgggggctcccggga
gacacaggacctaagggtgacaggggctttgatggcctgcccgggctgcctggtgagaag
ggccaaaggggtgactttggacgagtagggcaacctggtcccccaggagaggatggtgta
aagggcctgcagggacctccagggcccactggccaggctggagagccgggtccccgaggt
ctgattggccccagaggtctcccaggtcccctaggacgcccgggtgtgacagggagtgat
ggcgcaccaggggccaaaggcaacgtgggtcctcctggagaaccaggacccccaggacag
caaggaaaccacggctcccagggaattccaggcccccaggggcccattggcactcccggg
gaaaagggtccccctggaaaccccggaattccaggtgtcccaggatctgagggccccccg
ggccacccaggccacgagggtcccacaggagaaaaaggggctcagggcccaccaggatca
gcaggccctcggggctatcctggacttcgtggtgtgaagggtacctctggtaaccggggt
ctccaaggcgagaaaggagaaaggggagaggatggctttcctggcttcaagggtgatgag
ggaccaaaaggcgaccggggaaaccccggacccccaggtcccagaggagaggatggtcca
gaaggacaaaaggggcctgggggactgcctggtgatgagggtcctccaggagcagcaggg
gagaagggcaagcttggggtgccaggtctcccaggttatccaggacgcccaggacctaag
ggatctattggatttcctggacccttgggaccactgggggagaaaggcaagcggggcaaa
gcaggacagccaggagaggaaggagaacgcggcacaccgggcacccgaggagacagggga
cagccgggggccacaggccagcctggccccaagggtgacgtgggccagaatgggtctcct
gggccccctggagaaaagggtctacccggtcttcaaggcccaccaggattccccggacca
aaaggccccccgggtcctcaggggaaagatgggatatctgggcaccctggacaaagagga
gaattgggcttccaaggtctgacaggcccccctggaccagctggcgtccttggtcctcag
ggaaaggtaggggacgtggggcctctaggcgagagaggccccccagggcctcctggacct
cctggtgaacaaggtctgccaggcatagaaggcagagaaggggccaagggtgagctagga
cccctggggtccgtcgggaaggaggggccacctgggcccaggggcttccctggcccccaa
ggagcccccggagacccaggacccattggtttgaagggtgacaaaggtcccccaggccct
gttggggcaaatggctccccgggagagcgtggtcctgtaggcccctctggtggcattggg
cttcctggccagagtggagggcaaggccctattggtcctgctggcgagaaggggtccccg
ggagaacggggtactcctggtcctactggcaaagatggtattccaggacccccggggctt
cagggcccctctggagctgcggggccttctggggaagaaggagacaagggggaagtaggg
atgcctggtcacaaaggaagcaaaggggataaaggagatgcaggcccacctggaccaaca
ggaataagaggtccagcaggccattcaggcctcccgggtgctgatggcgctcagggtcgc
cggggaccccctggcctcttcgggcagaagggggatgacggagttcgaggctttgtaggt
gtaattggtcctccaggtctgcaggggctgccgggtcctccgggggagaagggcgaggtt
ggagacgtaggatccatgggtccacatggagctccaggccctcggggtccccctgggccc
agtggatcagagggccccccaggtctgcctggaggagtaggacagcctggtgctgtgggc
gagaagggtgagccaggggatgctggagacgccggacccccaggaattcccggcatccct
gggcccaaaggtgaaattggtgaaaagggggattcgggtccatcaggggctgctggtccc
ccaggcaagaaaggacccccaggagaggacggctctaaggggaacatgggtcccacagga
ctccctggagatctagggcccccaggagaccctggagttccgggtattgatggcatccca
ggggagaagggaaatgctggtgatattgggggaccggggccacctggagcttccggggaa
cctggtgcccgtggcctccctggcaagaggggttcccctggccgcatgggtccagaagga
agagagggcgagaaaggcgccaagggagatgctggtcctgatggacccccaggcaggaca
ggccccattggggctcgagggccccctggacgaattgggcctgatggtcttccagggatc
cctggtcctgtgggtgaaccaggtctcctgggacctcctgggctaatcggccctccaggg
cccctgggcccacctggcctccctggcctgaagggagatgctggccccaagggggagaag
ggccacattgggctaataggcctcattggtcccccaggggaggccggtgagaaaggcgat
caggggttgccaggtgtgcagggccccccaggccttcagggagaccctggtctccctggt
cctgttggctcgttaggtcaccctgggcccccaggtgtggtgggccctctgggacagaag
ggctccaaagggtccccgggatctcttggtcctcgtggagaccctggaccagcgggtcct
cctggtcccccgggttctccggctgaggtgcatggcctgcgcaggcgccgatctgtgacg
gacaccctggaaggtggcctggaggaggtgatggcctcactgaattcactgagcttggag
ctgcagcagttgcagagacctctgggcacagccgagagcccaggcctcatgtgccgagag
cttcaccgcgaccacccacacctgcccgatggagagtactggattgaccccaatcagggc
tgtgcacgtgacgccttcaaggttttctgcaacttcacggcaggaggtgagacctgtctc
tatccagacaagaagtttgagacggtgaaactggcctcgtggtcccgagagaagcctgga
ggctggtacagcaccttccgccgagggaagaagttctcctatgtggatgctgatggctcc
ccggtgaatgtggtccagttgaccttcctgaagttgttgagtgctgcagcccatcagagg
ttcacttacatctgccagaactcggtggcatggctggatgaagctgcgggtgaccacagg
cactccatccgcttccaagggaccaactgggaagagttgtccttcaaccagacaacagca
gctaccatcaaggtctcccatgatggctgtcgggtccggaagggacaggcgaagaccctc
tttgaattcagctcttctgtgggtttcctgcctctgtgggatgtggctgcctctgacttt
ggtcagacgaaccaaaagtttgggtttgaactcggctccatctgctttagcagctga

DBGET integrated database retrieval system