KEGG   Mus musculus (house mouse): 53868
Entry
53868             CDS       T01002                                 
Symbol
Rab25, AV012978
Name
(RefSeq) RAB25, member RAS oncogene family
  KO
K07906  Ras-related protein Rab-25
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    53868 (Rab25)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    53868 (Rab25)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    53868 (Rab25)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    53868 (Rab25)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase SRPRB AAA_22 Gtr1_RagA AAA_7 AAA_14 AAA_16 AAA_28 PduV-EutP AAA_24 TniB ABC_tran GTP_EFTU AAA_5 KAP_NTPase NACHT Septin
Other DBs
NCBI-GeneID: 53868
NCBI-ProteinID: NP_058595
MGI: 1858203
Ensembl: ENSMUSG00000008601
UniProt: Q9WTL2 Q0PD30
Position
3:complement(88449335..88455586)
AA seq 213 aa
MGNRTDEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAA
VKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVV
MLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQ
KQNSTRTSAITLGNAQAGQDPGPGEKRACCISL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggggaatcgaacagatgaagattataactttgtctttaaggtggtgctgatcggcgag
tcaggcgtgggcaagaccaatctgctgtcccggttcacccgcaatgagttcagccacgac
agtcgcaccaccatcggggttgagttctccacccgcactgtaatgctgggcaccgctgct
gtcaaggcacagatctgggacacggccggcctggagagatacagagccatcacctctgcg
tactatcgtggggccgtgggggcactcctggtatttgacctgaccaagcaccagacctac
gctgtggtggagcgctggctaaaggagctgtatgaccatgccgaagccacgattgttgtc
atgctcgtggggaacaaaagtgacctcagccaggcccgagaggtccctactgaggaggcc
tgcatgtttgctgaaaacaatggcctgctgttcctggagacgtcagccctcgactccacc
aatgttgagctagccttccagactgtcctcaaagagatctttgcaaaggtgtccaagcag
aagcagaacagcacccggaccagtgccatcaccctgggcaatgcccaagctggacaggat
cctggccctggggaaaagagggcctgttgcatcagcctctga

DBGET integrated database retrieval system