KEGG   Mus musculus (mouse): 53877Help
Entry
53877             CDS       T01002                                 

Gene name
Ear4, RNS2, Rnase2, mR4
Definition
(RefSeq) eosinophil-associated, ribonuclease A family, member 4
  KO
K01168  pancreatic ribonuclease [EC:4.6.1.18]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    53877 (Ear4)
   04131 Membrane trafficking [BR:mmu04131]
    53877 (Ear4)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.18  pancreatic ribonuclease
     53877 (Ear4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     53877 (Ear4)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    53877 (Ear4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA LPAM_1
Motif
Other DBs
NCBI-GeneID: 53877
NCBI-ProteinID: NP_001017422
MGI: 1858238
UniProt: O35291
Position
14; 14 C1
AA seq 155 aa AA seqDB search
MGPKLLESRLCLLLLLGLVLMLASCQAQILSQKFYTQHIYNSTYPRCDAVMRVVNRYRPR
CKDINTFLHTSFADVVAVCGHPNITCNNLTRKNCHASSFQVFITFCNLTMPTRICTQCRY
QTTGSVKYYRVACENRTPQDTPMYPVVPVHLDGTF
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgaagctgcttgagtcccgactttgtctcctgctgctgttgggacttgtccta
atgcttgcctcatgccaggcacaaatcctttcccagaagttttacacccagcatatctat
aatagcacctacccccgatgtgatgctgtaatgagggttgttaacaggtatagaccaaga
tgtaaggacataaatacttttcttcacacaagttttgctgatgttgttgctgtgtgtggc
catccaaatatcacctgcaacaacttgacaagaaaaaattgtcatgctagttcatttcag
gtatttataactttttgtaacctcactatgccgacaagaatatgcacacaatgcagatac
caaacgacaggttcagtgaagtactacagagtagcctgtgagaacagaactccacaagac
actcccatgtatccagtggttccagttcacttggatgggacattttag

DBGET integrated database retrieval system