KEGG   Mus musculus (mouse): 53883
Entry
53883             CDS       T01002                                 

Gene name
Celsr2, Adgrc2, EGFL2, Flamingo1, flamingo, mKIAA0279, mfmi1
Definition
(RefSeq) cadherin, EGF LAG seven-pass G-type receptor 2
  KO
K04601  cadherin EGF LAG seven-pass G-type receptor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    53883 (Celsr2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    53883 (Celsr2)
   04515 Cell adhesion molecules [BR:mmu04515]
    53883 (Celsr2)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   53883 (Celsr2)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Cadherin EGF LAG (CELSR)
   53883 (Celsr2)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   53883 (Celsr2)
SSDB
Motif
Pfam: Cadherin GAIN Laminin_G_2 7tm_2 Laminin_G_1 GPS Cadherin_3 EGF Laminin_EGF Cadherin_pro hEGF Cadherin_4 Dicty_CAR
Other DBs
NCBI-GeneID: 53883
NCBI-ProteinID: NP_059088
MGI: 1858235
Ensembl: ENSMUSG00000068740
Vega: OTTMUSG00000007107
UniProt: Q9R0M0
Position
3 F3; 3 47.02 cM
AA seq 2919 aa
MRSRAASAPLPTPLLPLLLLLLLLPPSPLLGDQVGPCRSLGSGGRSSSGACAPVGWLCPA
SASNLWLYTSRCRESGIELTGHLVPHHDGLRVWCPESGAHIPLPPSSEGCPWSCRLLGIG
GHLSPQGTLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGEGSPEESLGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPITGV
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGAGGSPSDAFEIDPRSGVIRTRGPVDREEV
ESYKLTVEASDQGRDPGPRSSTAIVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRIRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL
EYSLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTI
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCSLRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCLDGYTG
EHCEASTHSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPFCQVTTRSFPARSFITF
RGLRQRFHFTLALSFATKERNGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVS
PFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVSVDGCDTGVALRFGAMLG
NYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRHFVGCMKDLQVDSRHIDMAD
FIANNGTVPGCPTKKIVCDSSICHNGGTCVNQWNAFSCECPLGFGGKSCAQEMANPQRFL
GSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLRAGHVVLSVEGT
GLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQKAEGNLGPRLHGLHLS
NITVGGVPGPASGVARGFRGCLQGVRVSETPEGISSLDPSRGESINVEPGCSWPDPCDSN
PCPTNSYCSNDWDSYSCSCVLGYYGDNCTNVCDLNPCEHQSVCTRKPNTPHGYICECLPN
YLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPT
CLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAI
EAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERL
QRNESGLDSGRSQRLALLLRNATQHTSGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQ
DVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPF
TIVTPNIVISVVRLDKGNFAGTKLPRYEALRGERPPDLETTVILPESVFREMPSMVRSAG
PGEAQETEELARRQRRHPELSQGEAVASVIIYHTLAGLLPHNYDPDKRSLRVPKRPVINT
PVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCE
VVFRNESHVSCQCNHMTSFAVLMDMSRRENGEILPLKTLTYVALGVTLAALMLTFLFLTL
LRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLE
ALHLYRALTEVRDVNASPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSVYDTLI
WSFAGPVAFAVSMSVFLYILSARASCAAQRQGFEKKGPVSGLRSSFTVLLLLSATWLLAL
LSVNSDTLLFHYLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTL
TSSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQVPPGLG
DPSGLFLEGQAQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEAAFPGEQGWDSL
LGPGAERLPLHSTPKDGGPGSGKVPWLGDFGTTTKENSGSGPLEERPRENGDALTREGSL
GPLPGPSTQPHKGILKKKCLPTISEKSSLLRLPLEQGTGSSRGSSISEGSRHGPPPRPPP
RQSLQEQLNGVMPVAMSIKAGTVDEDSSGSEFLFFNFLH
NT seq 8760 nt   +upstreamnt  +downstreamnt
atgcggagccgggctgccagcgcccccctcccaacgccgctgctgccgctgctactgctg
ttgctgctgctgccaccgtcgccactactgggagatcaagtggggccctgtcgttctctg
ggatccgggggacgcagctcctctggggcctgcgcccccgtgggctggctctgcccagcc
tctgcttcgaacctctggctctacaccagccgctgcagagaatcgggcattgagctgacc
ggccacctggtgccccaccacgatggcctgagggtttggtgtccagaatcaggggctcat
atccctcttccgccatcctctgaaggctgcccctggagctgtcgtctcctgggtatcgga
ggacacctttctccacaaggcacgctgaccctgcctgaagagcacccttgcttaaaggcc
ccacggctcagatgccagtcttgcaagctggcacaggccccagggctcagggctggggaa
ggctcaccagaggaatctctgggtgggcgcaggaaaaggaatgtgaatacagctccccag
ttccagcctcccagctaccaggccacagtgcctgagaaccagcctgctggtacctctgtt
gcatccttaagagccattgatccagatgagggtgaggcgggtcgacttgagtacaccatg
gatgccctctttgatagccgctccaatcatttcttctccttggacccaatcaccggtgtt
gtcaccacagctgaggagctggatcgggagaccaagagcacccacgtcttcagggtcact
gcacaggatcacggtatgccccgacggagtgccttggccacgcttaccatcttggtgacc
gacaccaacgatcacgaccctgtttttgagcagcaagagtacaaggagagcctcagggag
aacctggaggttggctatgaggtgcttacagtcagggccaccgacggcgacgcccctccc
aatgccaacattctgtaccgcctgctggagggggccggaggcagcccctcagacgccttt
gagatcgatcctcgctcgggggtgatccgaacccgcggccctgtagaccgggaggaagtg
gaatcctacaagttaacagtggaggcgagtgaccagggccgggacccaggcccgcggagt
tccacagccattgttttcctgtcggtggaggatgataatgacaacgccccccagtttagc
gagaagcgttatgtggtccaggtgcgggaggatgtgaccccaggagccccagttctccga
gtcaccgcctccgatagagacaagggcagcaatgccctagtgcactacagcatcatgagt
ggcaatgctcggggccagttctatctggatgctcagactggagccctggatgtggtaagc
ccactcgactatgagacaaccaaagagtatacgcttcggatccgggctcaggacggtggc
cgtcctccactctccaatgtctctggcctagtaacagtgcaagtcctagacatcaacgat
aacgcccccatctttgtcagcacccctttccaggccaccgtcctagagagtgtcccttta
ggctaccttgttctgcacgtccaggcaattgatgctgacgctggtgataacgcccgcctc
gagtatagcctggcaggggttgggcacgactttcccttcaccattaacaatggcacaggc
tggatctctgtggccgcagagttggatcgggaagaggttgatttctacagctttggtgta
gaggcccgggaccatggcaccccagcgctcacggcctcagccagtgtcagtgtaaccatc
ctggacgtcaatgacaacaacccaaccttcacgcagccagagtacaccgttcggctcaac
gaggacgccgccgtgggcaccagtgtggtgaccgtgtcagccgtggatcgagacgctcac
agtgtcattacctaccagatcaccagcggcaacacccgcaaccgcttctctatcaccagc
caaagtggtggtggactggtctcccttgccttaccgctagactacaaactcgagcggcag
tatgtgctggcagtgactgcctcagatggcacaaggcaggacacagctcagatagtagtg
aatgtcaccgatgccaacacccaccgtcccgtcttccagagctcccactacacagtcaac
gttaatgaagaccggccagcaggcaccacagtggtgctgatcagcgccacggatgaggac
acgggggagaatgcccgaatcacctactttatggaggatagcatcccccagttccgaatc
gacgcggacactggggctgtcaccacccaggctgagctggactacgaggaccaggtgtct
tataccctggccatcactgctcgggacaatggcattccccagaagtctgacaccacctat
ttggagatcctggtgaatgacgtgaacgacaacgccccccagttcctcagagattcctac
cagggcagcgtctacgaggacgtgccgcccttcaccagcgtcctgcagatctcagccacg
gatcgagactccggtctgaatggcagggttttctacaccttccaaggaggagatgatggg
gacggtgactttattgtagagtcgacatcgggcattgtgcgcacactgcggaggctggat
cgtgagaacgtggcccagtacgtcctgcgggcctatgcggtggacaagggcatgccacca
gcccgcacacccatggaagtgacagttactgtcctggatgtgaatgacaacccccctgtc
tttgaacaggatgagtttgacgtatttgtggaagagaacagccccatcgggctggccgtg
gcccgggtcacagccactgacccagatgaagggaccaacgcacagatcatgtaccagatt
gtggagggcaatatccctgaggtctttcagttggatatattctctggcgagctaactgcc
ctggtagatttggactatgaggaccggcctgaatatgtcctggtcatccaggctacgtct
gctcccttggtgagcagggctactgtccatgtccgcctccttgaccgcaatgataacccg
cccgtgctgggcaactttgagattctctttaacaactatgtcaccaaccgctccagcagc
ttccccggtggtgccataggccgtgtgcctgcccacgaccccgatatctcagacagcctg
acgtacagcttcgagcgaggaaatgaactcagcttggtcctgctcaatgcctccaccggt
gagctgagactgagccgggcactggacaacaaccggcccctggaagccatcatgagtgtg
ctggtgtcagatggtgtccacagtgtgacagcccagtgctcgctacgtgtcaccatcatc
acggacgagatgctcacacacagcatcacgctgcgcttggaagacatgtctccagaacgc
tttctctcaccactgctgggactcttcattcaggccgtggcagccacgttggccacaccc
ccggatcatgtggtggtcttcaatgtgcaaagggatactgatgccccaggcggccatatc
ctcaacgtaagcctgtcggtgggccagcctccaggacccgggggtgggccaccctttctg
ccttcagaggatctccaggagcgcctgtacctcaaccgcagcctgctcaccgccatctcg
gcgcagcgcgtgctccccttcgacgacaacatttgcctgcgggagccctgcgagaattac
atgcgatgtgtgtctgtgctgcggttcgactcctctgcgcccttcatcgcttcctcttcg
gtgctcttccggcccatccaccctgtcgggggtctgcgctgtcgctgcccaccaggcttc
acaggcgactactgcgagaccgaggtggacctctgttactcaagaccttgtggaccccat
gggcgctgccgcagccgagagggtggctatacctgcctctgtctggatggctacacgggc
gagcactgtgaagcgagtacccactcaggccgttgtactccaggtgtctgcaagaacggg
ggtacctgtgtcaacctgttggtgggaggtttcaaatgtgactgcccctccggggacttt
gagaaacccttctgccaggtgaccacacgcagcttccctgcccgctccttcatcaccttc
cgtggcctgcgccagcgcttccacttcaccctggccctctcgtttgctaccaaggagcgt
aacgggctactgctgtacaatgggcgcttcaatgagaagcacgactttgtggctctcgag
gtgatccaggaacaggtgcagctcaccttctctgcaggggaatcgaccaccaccgtgtct
ccgtttgtgccgggaggggtcagtgatggccagtggcacacagtgcagctgaagtactat
aacaagccactgttgggtcagacagggcttccccaaggtccatctgagcagaaggtagcc
gtggtgtccgtggatggctgtgacacaggggtggctctgcgctttggagctatgctgggc
aactactcctgtgctgcccagggcacccaaggaggcagcaagaagtctctggacctgaca
gggcccttgttgctgggtggggtgccggatctgcccgagagcttccccgtccgaatgcgg
cactttgtgggctgcatgaaggacctccaggtggatagccggcacatcgacatggccgac
ttcattgccaacaatggcactgtgcctggctgccccaccaagaagatcgtgtgcgacagc
agcatttgccacaacggtggcacctgtgtgaaccagtggaatgcgttcagctgcgagtgt
ccactaggcttcgggggcaagagctgcgcccaggaaatggccaacccccagcgtttcctg
ggcagcagccttgtggcctggcatggcctctctctgcccatctctcagccctggcacctc
agcctcatgttccgcacacgccaggcagatggcgtcctgctgcaggccgtcaccaggggg
cgcagcaccatcaccctgcagcttcgggcaggccacgtagtgctaagtgtggagggcaca
gggctccaggcgtcatctctgcgtcttgagccaggccgagccaatgatggtgactggcat
catgcacagctggcactgggagccagcgggggccctggccatgccattctgtcctttgac
tatgggcaacagaaggcagagggtaatctgggccctcggctgcatggactgcacctgagc
aatattacagtcgggggagttcctgggccagccagcggagtggcccgtggcttccggggc
tgtttgcagggtgtcagggtaagcgagacacctgagggtatcagcagtctagatcccagc
cgcggggagagcatcaatgtggagccaggctgtagctggccagatccctgtgactcgaat
ccatgccctaccaacagctactgcagcaatgactgggacagctattcttgtagctgtgtt
ctaggttactatggtgacaactgtacaaatgtgtgtgacctgaacccatgcgagcaccag
tccgtgtgtacccgaaaacccaatacaccccacggctacatctgcgagtgtttaccaaat
taccttgggccatattgtgagaccaggattgaccaaccttgcccccgtggctggtgggga
caccccacatgtggtccatgcaactgtgatgtcagcaaaggctttgacccagattgcaac
aagacaagtggggagtgccactgcaaggagaatcactaccggccccccggcagccccact
tgtctcttgtgtgactgttaccccactggttctttgtcccgagtctgtgaccccgaggac
ggccagtgtccgtgcaagcctggagtcattgggcgtcagtgtgaccgctgtgacaaccct
tttgctgaggtcaccaccaatggctgtgaagtgaattacgacagctgcccacgggccata
gaggctgggatctggtggccccgcacgcggttcgggctacctgctgctgccccctgcccc
aaaggctcctttgggactgctgtgcgccactgtgatgagcacaggggttggctcccccca
aacctcttcaactgcacgtcagtcaccttctcagagctaaagggcttcgctgagcggctg
cagaggaacgaatcaggcctggactcaggacgctcccagaggctagccctgctcctgcgc
aatgccacccagcacacctctggctacttcggcagtgatgtcaaggtggcctaccagctg
gccacacggctcttggctcatgagagtgcccagcggggctttgggctatccgccacacag
gatgtacacttcacggagaatctgctgagggtgggcagcgccctcctggatgcagccaac
aagaggcactgggaactgatccagcagacagagggtggcaccgcctggctgctccagcac
tatgaggcttacgccagcgcccttgcccagaatatgcggcacacctacctaagccccttc
accatcgtcacacccaacattgtcatctctgtagtgcgcctggataaggggaactttgct
gggaccaagctgccccgttatgaggcattacgtggggagcgccccccagatcttgagacc
acagtcattttgccagaatctgtcttcagagagatgccctccatggtgaggtctgcagga
cctggtgaagcccaggagacggaggagctggcccggcggcagcggaggcacccagaactg
agtcagggagaggcagtggccagtgtcatcatctaccacaccctggctggactgctgccc
cacaactatgaccccgataagcgtagcctgagagtccccaagcgccccgtcatcaacacc
cctgtggtgagcatcagcgttcacgacgacgaggaactcctgccgcgggctctggacaag
ccagtcaccgtgcagttccggctgctggagaccgaggagcggaccaagcccatctgtgtc
ttctggaaccattcaatcctggtcagtggcactggcggctggtccgcccgaggctgcgaa
gtcgtcttccgtaacgagagccacgtcagctgccagtgcaaccatatgacaagctttgct
gtgcttatggatatgtcacgacgagagaacggtgagatcttgccactgaagaccctgaca
tacgtggcccttggagtcaccttggctgccctgatgctcaccttcctcttcctcaccctc
ctccgtgccctccgctccaaccagcacggcatccgacgcaacctcacagctgccctgggc
ctggcccagctggtctttctcctgggcatcaaccaggctgacctcccttttgcctgtaca
gtcatcgctatcctgctgcatttcctgtacctctgcaccttctcctgggctctgctggag
gccttacacctgtaccgcgcgctcacagaggtgcgcgacgtcaatgccagtcccatgcgt
ttctactacatgctgggctggggcgtccctgctttcatcacaggcctcgctgtgggcttg
gatccggaaggctatgggaaccctgacttctgctggctctctgtctatgataccctcatc
tggagctttgctggaccagtggcctttgctgtttcgatgagtgtcttcctgtacatcctg
tcggcccgagcctcctgtgctgcccaacggcagggcttcgagaagaaagggcctgtctcg
ggcctgcgctcctccttcacggtcctcctgctgctgagtgccacgtggctgctggcactg
ctctctgtcaacagtgacactctgctcttccactacctcttcgctgcctgcaattgtgtc
cagggccccttcatcttcctctcctacgtggtgctcagcaaggaggtccggaaagcactc
aagttcgcctgcagccggaagcccagtcccgaccctgccttgaccactaagtctaccctg
acctcgtcctataactgccccagcccctacgcagacgggaggctgtaccagccttacgga
gattcggctggctcgttgcacagtgccagccgctccggcaagagtcagcccagctacatc
cccttcttgctgagggaggagtccacgctgaaccctggccaggttccccctggcctaggg
gacccaagcggcctgttcttggaaggccaagcccaacaacatgatcccgacacggactct
gacagtgacctgtccctggaagatgaccagagtggttcctatgcctccacccactcatca
gacagcgaggaagaggaggaggaggccgccttccctggcgagcagggctgggacagcctg
ctgggtcctggagctgagagactgccccttcacagtacccccaaggatgggggtccgggt
tctgggaaggtcccttggctgggagactttgggaccacaacaaaggagaatagtggtagt
gggccccttgaagagcggccacgggagaatggagatgccctaactcgggaagggtctctg
ggaccccttccgggcccttctacccaacctcacaaaggcatcctcaagaagaagtgtctg
cccaccatcagcgaaaagagcagcctcctaaggctgcccctggagcagggcacagggtct
tctcggggctcctccatcagtgagggcagtcggcacggacctcctccccgcccacctccg
cgccagtctctgcaggaacagctgaatggggtcatgcctgtcgccatgagcatcaaggca
ggcacggtggatgaggactcctctggctctgaatttctcttctttaacttcctgcattaa

DBGET integrated database retrieval system