KEGG   Mus musculus (mouse): 53893
Entry
53893             CDS       T01002                                 

Symbol
Nudt5
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 5
  KO
K13987  ADP-sugar pyrophosphatase / 8-oxo-dGDP phosphatase / ADP-D-ribose pyrophosphorylase [EC:3.6.1.13 3.6.1.58 2.7.7.96]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    53893 (Nudt5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.96  ADP-D-ribose pyrophosphorylase
     53893 (Nudt5)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     53893 (Nudt5)
    3.6.1.58  8-oxo-dGDP phosphatase
     53893 (Nudt5)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 53893
NCBI-ProteinID: NP_058614
MGI: 1858232
Ensembl: ENSMUSG00000025817
Vega: OTTMUSG00000010875
UniProt: Q9JKX6
Position
2; 2 A1
AA seq 218 aa
METRESTESSPGKHLVTSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADA
VSVIPVLQRTLHHECVILVKQFRPPMGSYCLEFPAGFIEDGESPEAAALRELEEETGYKG
EVAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPGDGEFMEVISLPKNDLLTR
LDALGAEQHLTVDAKVYAYGLALKHANSKPFEVPFLKF
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagacccgagaatccacagagtcttctccaggcaagcaccttgttacctcagaggag
ttgatctcagaaggaaaatgggtcaaatttgaaaaaacaacttatatggatcccactggt
aaaaccagaacttgggaaacagtgaaacttacaaccaggaagggaaaatctgctgatgcc
gtgtcggtcatacctgtgctgcaaagaaccctgcaccatgagtgcgtcatcctggtgaag
cagttccggcccccgatgggcagctactgcctggagtttccagcagggttcatcgaagac
ggagaaagcccagaggcggctgctcttcgggagctggaggaagaaactggctacaaaggt
gaagttgcggaatgctctccagctgtgtgcatggatccaggcttgtcaaactgcaccaca
catgttgtgacagtgaccatcaatggagatgatgcaggaaatgtaaggccaaaacccaaa
ccaggggatggagaatttatggaagtgatttctttaccaaagaatgatctgctgacaaga
cttgacgctttgggagcagaacaacaccttacagtggatgccaaggtctacgcctacggt
ctggctctgaaacacgccaactcgaagccattcgaagtgcccttcctcaaattttaa

DBGET integrated database retrieval system