KEGG   Mus musculus (mouse): 54120
Entry
54120             CDS       T01002                                 

Gene name
Gipc2, 2200002N01Rik, AU021850, Semcap2
Definition
(RefSeq) GIPC PDZ domain containing family, member 2
  KO
K20056  PDZ domain-containing protein GIPC
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54120 (Gipc2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    54120 (Gipc2)
SSDB
Motif
Pfam: PDZ
Other DBs
NCBI-GeneID: 54120
NCBI-ProteinID: NP_058563
MGI: 1889209
Ensembl: ENSMUSG00000039131
Vega: OTTMUSG00000031664
UniProt: Q9Z2H7
Structure
PDB: 
5V6H

Position
3; 3 H3
AA seq 314 aa
MPLGLRGKKKAAKSKEAARLVEGERSSGSQGVPGPPAPARKLVFHAQLAHGSATGRVEDF
SSISELYAKIAGVFEIAPSEILFCTLNTPKIDMGKLLGGQLGLEDFIFAHVKGTKKEVNV
YKSEDSLGLTITDNGVGYAFIKRIKDGSTIDSVKTICVGDHIECINGENIVGWRHFEVAK
KLKELKKEELFTLQLIEPKKAFEIGPRSKAGKTSTEKIGTSRGTLRLRSKGPATVEELPS
EAKAKAIGKVDDLLELYMGIRDIDLATTMFEAGKDKSNPDEFAVALDETLGDFAFPDEFL
FDVWGAISDMKQGR
NT seq 945 nt   +upstreamnt  +downstreamnt
atgccgcttggactgcgcgggaagaagaaggcggccaagtccaaggaggccgcgaggctg
gtggagggcgagagatccagtggcagccagggtgtccccggacccccagctccggcacgc
aagctggtgttccacgcacagctggcgcacggcagcgccacgggccgagtggaggacttc
tccagcatcagcgagctctacgccaagattgccggcgtgttcgagatcgcgccatccgag
atcttattttgtaccttaaatacgcctaaaattgacatgggaaagctcctgggtgggcag
ctgggccttgaggatttcatatttgcccacgtgaaaggcacaaaaaaggaagtgaatgtt
tataaatcagaggattcgcttggactcaccatcacggataacggcgtgggctatgctttt
atcaagagaattaaagatggcagcaccattgactcagttaaaacgatctgtgtgggggat
catatcgaatgtataaacggagaaaatattgttgggtggcgtcactttgaagtcgctaag
aagttaaaggaattgaaaaaggaggagctctttactttgcagttaatagaacccaagaag
gcttttgaaataggaccaaggtcgaaagccggaaagacatcaacagaaaaaattggtact
tcaagagggaccctccgtctgagatcgaaaggccccgctacagtagaagagctgccctct
gaagccaaggcaaaggcaatcggaaaggttgatgatctccttgagctgtacatggggatt
cgagatattgacttagctacaaccatgtttgaagctgggaaagacaagagcaacccagat
gagtttgctgtcgctcttgacgagactctgggagactttgcctttcctgatgagttcctg
ttcgacgtgtggggagccatcagtgacatgaaacaaggaagatga

DBGET integrated database retrieval system