KEGG   Mus musculus (mouse): 54130Help
Entry
54130             CDS       T01002                                 

Gene name
Actr1a, Arp1, actin-RPV, alpha-Arp1
Definition
(RefSeq) ARP1 actin-related protein 1A, centractin alpha
  KO
K16575  centractin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    54130 (Actr1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    54130 (Actr1a)
   04147 Exosome [BR:mmu04147]
    54130 (Actr1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     54130 (Actr1a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     54130 (Actr1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   54130 (Actr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 54130
NCBI-ProteinID: NP_058556
MGI: 1858964
Ensembl: ENSMUSG00000025228
UniProt: P61164
Position
19; 19 C3
AA seq 376 aa AA seqDB search
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgttgtgatcgacaacggatccggtgtg
attaaagctggctttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
agacccaaacatgttcgtgtcatggcaggagccctggaaggtgacatcttcattggcccc
aaagcggaggagcaccgggggctgctgtcaatccgttaccccatggaacatggcatcgtc
aaggactggaacgacatggaacgcatctggcaatacgtctactctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctaacggaggcacctttaaaccctcggaaaaac
cgggagcgagctgcagaagtcttcttcgagaccttcaatgtgccggccctcttcatctcc
atgcaagccgtgctgagcctttatgccacgggcagaaccacaggcgtggtgttggattct
ggggatggtgtcacccatgcagtcccgatttatgaaggcttcgccatgcctcactccatc
atgcgcatcgacatcgctggccgggatgtctcacgcttcctccgcctctacctacggaag
gagggctatgatttccactcctcctctgagtttgagattgtcaaggccataaaggaaaga
gcttgctacctgtccataaacccccagaaggatgagacactggagacagagaaggctcag
tactacctgcccgatggcagcaccattgagattggcccttcccggttccgggcccctgag
ctgctgttcaggccggacttgattggcgaggagagtgaaggcatccacgaggtgctggtg
tttgctatccagaagtcagacatggatttacggcgtacactgttttccaacattgtcctc
tcaggaggttctaccctgttcaaaggttttggagacaggctactgagtgaagtgaagaaa
ctagctccaaaagacgtgaagatcaggatatctgcaccccaggagagactgtattccaca
tggattggaggttctatccttgcttccctggacacctttaagaagatgtgggtctctaag
aaagaatatgaagaagacggtgcccgatccatccacaggaaaaccttctaa

DBGET integrated database retrieval system