KEGG   Mus musculus (mouse): 54132Help
Entry
54132             CDS       T01002                                 

Gene name
Pdlim1, CLP36, Clim1, mClim1
Definition
(RefSeq) PDZ and LIM domain 1 (elfin)
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    54132 (Pdlim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4749 PDZ LIM PDZ_6 PDZ_2 DUF5447 Lar_restr_allev
Motif
Other DBs
NCBI-GeneID: 54132
NCBI-ProteinID: NP_058557
MGI: 1860611
Ensembl: ENSMUSG00000055044
Vega: OTTMUSG00000043391
UniProt: O70400
Position
19; 19 C3
AA seq 327 aa AA seqDB search
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSS
MTHLEAQNKIKGCADNMTLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
NRSAMPFTASPAPSTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPVVQP
HPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKA
PVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHRHPECYVCTDCGINLKQKGHFFVE
DQIYCEKHARERVTPPEGYDVVTVFRE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccagcagattgttctccagggcccgggtccctggggtttccgcctcgtgggc
ggcaaggacttcgaacaacctctcgccatttcccgggtcactcccggaagcaaggctgct
atagcgaatttatgtattggagatttaatcacagccatcgatggggaagataccagcagc
atgacacacttggaagctcagaacaaaatcaagggctgcgcagacaacatgacgctcaca
gtatccaggtctgaacagaagatttggtctcctctagtgaccgaggaggggaaacgtcat
ccctacaagatgaatttagcgtcggaaccccaagaagtcctgcacataggaagtgcccac
aaccgaagtgccatgccatttactgcctcacctgctcccagcacccgggtcatcacaaac
cagtacaacagcccaactggcctctactcatccgaaaacatctctaacttcaacaatgct
gtggagtcgaagacctcagccagtggggaggaggcgaacagcaggcccgtggttcagcct
catccctccggcagccttatcattgacaaggactctgaagtttacaagatgcttcaggag
aagcaagaattaaacgagccccccaaacagtccacatccttcctggttctgcaggagatc
ctggagtcagatgggaaaggggatcccaacaagccatcaggatttagaagtgttaaagct
ccagtcaccaaagtggctgcatctgttggaaatgctcagaagctgcccatctgtgacaaa
tgtggaactggtattgttggtgtgtttgtgaagctgagggatcaccatcgccaccctgaa
tgctatgtgtgcaccgactgtggcatcaacctgaaacagaagggccatttctttgtagag
gatcagatctactgtgaaaagcatgcccgggagcgggtcactccgcctgagggctacgat
gtggtcacagtgttccgcgagtga

DBGET integrated database retrieval system