KEGG   Mus musculus (house mouse): 54138
Entry
54138             CDS       T01002                                 
Symbol
Atxn10, AI325283, C77170, E46, Sca10, TEG-169, Tex169
Name
(RefSeq) ataxin 10
  KO
K19323  ataxin-10
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    54138 (Atxn10)
SSDB
Motif
Pfam: Atx10homo_assoc Cnd1
Other DBs
NCBI-GeneID: 54138
NCBI-ProteinID: NP_058539
MGI: 1859293
Ensembl: ENSMUSG00000016541
UniProt: P28658
Position
15:85220456..85348038
AA seq 475 aa
MAAPRMPPSRLSGIMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSTHA
VELACRDPSQVEHLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIGVAVDLVLLFRE
LRVEQDSLLTAFRCGLQFLGNVASRNEESQSIVWVHAFPELFMSCLNHPDKKIVAYCSMI
LFTSLNAERMKDLEENLNIAINVIEAHQKHPASEWPFLIISDHFLKSPELVEAMYGKLSN
QERITLLDIVIAKLVGEEQLTKDDISIFVRHAELIANSFMDQCRNVLKLTSEPHTEDKEA
LVTIRLLDVLCEMTSNTELLGYLQVFPGLMERVIDVLRVIHEVGKESTNIFSPSDSLKAE
GDIEHMTEGFKSHLIRLIGNLCYKNKENQDKVNELDGIPLILDSSNIDDNNPFMMQWVVY
AVRNLTEDNSQNQDVIAKMEEQGLADASLLKKMGFEIEKSGDKLILKSNNDIPPP
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggcgcccaggatgccaccctcccggctgtcgggcatcatggtgcccgcacccatc
caggacctggaggccttgcgcgcgctcacggcgctcttcaaggagcagcgtaaccgggaa
acagcacccagaacgatcttccagagagtcctggatatcttaaagaagtctactcatgct
gttgagctggcctgcagggatccctcccaagtggaacatctggcttccagtctgcagcta
atcactgaatgcttcagatgtcttcggaatgcttgtatagagtgttctgtgaatcagaat
tccatcaggaacctggatacgatcggagttgctgttgatttggttcttctctttcgtgaa
cttcgggtggaacaagactccttgttgacagcttttcgatgtggcctgcagtttttaggc
aacgttgcctcacgaaatgaagaatcccagtccattgtttgggtccacgccttcccagaa
ctcttcatgtcttgcttgaaccatccagacaaaaagattgttgcctactgttccatgatt
ctgttcacatctcttaatgctgaaaggatgaaagacctggaagagaacctcaatattgca
attaacgtcatagaagctcaccaaaagcacccggcgtcagagtggccgttcttgattatt
tcagaccactttctgaaaagcccggaactggtggaagctatgtatggcaaactcagcaac
caggaaaggatcacactgttagacatagtgatagccaagctagtgggtgaggagcagctg
acaaaggatgacatctctatctttgtgcgccatgccgagttgattgcaaactcatttatg
gatcagtgcaggaacgtgctgaagttgacctcagagcctcacaccgaggataaggaagcc
ctggttacgattcggctcctggatgtcttgtgtgaaatgacgtccaacactgagcttctc
ggctacctgcaggttttccctggcctgatggaacgcgtgattgatgttttacgagtgatt
catgaagttggaaaagaaagcacgaacatcttcagtccctcagactctctaaaagcagag
ggtgacatcgaacacatgactgaaggctttaagtctcatctcatccgtctgattggaaat
ctgtgctacaagaataaagaaaaccaagacaaagtgaatgagctggatggcattcctctg
atcctggacagcagcaacatcgatgacaacaacccctttatgatgcagtgggtggtgtat
gctgtgcgaaatctcactgaagacaacagccaaaaccaagatgtcattgccaagatggag
gagcagggcttggcagacgcatccctactgaagaaaatgggctttgaaattgaaaagagt
ggggataaactgattctgaagtctaataatgacatccccccgccttga

DBGET integrated database retrieval system