KEGG   Mus musculus (mouse): 54160
Entry
54160             CDS       T01002                                 

Gene name
Copg2, AW227625, gamma-2-COP
Definition
(RefSeq) coatomer protein complex, subunit gamma 2
  KO
K17267  coatomer subunit gamma
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54160 (Copg2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    54160 (Copg2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    54160 (Copg2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   54160 (Copg2)
SSDB
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 HEAT_EZ HEAT MOR2-PAG1_C UNC45-central PuR_N
Other DBs
NCBI-GeneID: 54160
NCBI-ProteinID: NP_059506
MGI: 1858683
Ensembl: ENSMUSG00000025607
Vega: OTTMUSG00000014455
UniProt: Q9QXK3
Position
6; 6 A3.3
AA seq 871 aa
MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEH
FGTMEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVY
RGPAIRALCRITDGTMLQAVERYMKQAIVDKVSSVASSALVSSLHMMKISYDVVKRWINE
AQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLL
KESEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRL
MKQISSFVSEISDEFKVVVVQAISALCHKYPRKHSVMMTFLSNMLRDDGGFEYKKAIVDC
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRV
VLENEAVRAAAVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQM
ALNATYIFNGLTVSIPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKSEITLVTPKP
EKLAPSRQDIFQEQLAAIPEFMNLGPLFKSSEPVQLTEAETEYFVRCVKHMFTDHIVFQF
DCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAPSLPYNQPGICYTLVRLPDEDPTAVAGT
FSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKILKPNFAAAWEEVGDAF
EKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVR
SRLALADGVTMQVTVRSKERTPVDVILASVG
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgattaaaaaattcgacaagaaggacgaggagtctggtagtggttccaatcctttccag
catttggagaagagtgctgtcttgcaggaggcacgcatattcaacgaaacgcccatcaat
ccaagaagatgcttgcatatcttgacaaagattctttacttactcaaccagggtgaacac
ttcggaactatggaagctacagaagccttctttgcaatgactcgattgtttcaatctaat
gatcaaacgctgaggcggatgtgctacctcaccatcaaggaaatggccaccatctctgag
gatgtgatcattgtcacaagcagtctgaccaaggacatgactggaaaggaagatgtatac
cgaggcccagccatcagggctctctgcagaatcacagatggaacaatgttgcaagccgtt
gaaaggtacatgaagcaggccattgtggataaagtatccagtgtagccagctcagcgctg
gtctcttccttacacatgatgaagataagctatgatgtggttaaacgatggataaatgaa
gcccaagaagctgcatcaagtgacaatatcatggtgcagtaccatgcactaggagtgctc
tatcaccttaggaagaatgatcggcttgctgtctccaagatgttaaataagtttaccaaa
tctggtctcaaatcacagtttgcatactgtatgctgattcgaattgctagtcgcttactg
aaagaaagcgaggatggtcatgaaagtccactctttgatttcattgagagctgcttgcga
aataaacacgaaatggttatttatgaagctgcttctgccattattcatcttcccaactgt
actgcaagagagctggcacctgctgtctcagttcttcaacttttctgtagctctcctaaa
ccagccttgagatatgcagctgtgaggaccctgaacaaggtggcaatgaagcacccctct
gctgttactgcctgcaatctggacttagaaaacttaatcacagactcaaacaggagcatt
gctaccctggccattacaacattgctcaaaacaggaagcgagagcagtgtagacaggctt
atgaagcagatatcttcttttgtgtctgaaatctcagatgagttcaaggtggtggtcgtg
caggccatcagtgctctctgtcacaagtaccctcggaagcacagcgtcatgatgactttt
ctttccaacatgcttcgagatgatggaggttttgaatacaaaaaggccattgtggactgc
ataatcagcattgtggaagagaaccctgagagtaaagaagctggtctagcccacctctgt
gaattcattgaggactgtgaacataccgttctggctactaaaattctccacttattgggc
aaagagggccctagaactcctgttccctccaagtatatcagattcatttttaatagggtg
gtcctggagaatgaggctgtcagagctgctgctgtgagtgctttggctaaatttggggct
cagaatgagagccttctccccagcatccttgtactcttacaaaggtgtatgatggatact
gatgatgaggtacgggaccgagctaccttctacctgaatgtgctacagcagagacagatg
gccctgaatgctacatatatcttcaatggtctgacagtctctataccagggatggaaaag
gccttacaccagtatacattggagccttcagaaaaaccctttgatatgaagtcaattcct
cttgctatggctcctgtctttgagcagaagtcagaaattacacttgtgactcctaagcca
gagaagttggctccttccaggcaagacattttccaagaacagttagctgccattcctgag
tttatgaacctgggacccttgtttaagtcttctgagcctgtgcagcttacagaagcagag
acagagtatttcgttcgctgtgtgaagcacatgtttactgaccatattgtattccagttt
gactgtaccaacactctaaatgaccagctgctggagaaagtaacagtgcagatggaacca
tccgattcctatgaagtgctgtgctgtatcccagctcccagcctcccttacaatcagcca
ggaatatgctacacacttgttcgattgccagatgaagatcctacagcagttgcaggcacc
tttagctgtaccatgaagttcacagtccgggattgtgaccctaatactggagttccagat
gaagatggatatgatgatgaatatgtgctggaagatcttgaagtaactgtgtctgatcat
attcagaagatactaaaacctaacttcgctgctgcctgggaagaggtgggagatgccttt
gaaaaagaagaaacctttgccctgagctctacaaaaacccttgaagaagctgtcaacaac
atcatcacatttcttggtatgcagccatgtgagaggtcagataaagtccccgagaataag
aactcccactccctctatctagcaggtgtatacagaggtggctatgacttattggtgcgg
tccaggctggccctagctgatggagtgaccatgcaggtgactgtgagaagcaaagagaga
acgcctgtggatgttatcttggcttctgtgggataa

DBGET integrated database retrieval system