KEGG   Mus musculus (mouse): 54167Help
Entry
54167             CDS       T01002                                 

Gene name
Icos, AILIM, CCLP, CRP-1, H4, Ly115
Definition
(RefSeq) inducible T cell co-stimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    54167 (Icos)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    54167 (Icos)
   04672 Intestinal immune network for IgA production
    54167 (Icos)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    54167 (Icos)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    54167 (Icos)
CD molecules [BR:mmu04090]
 Proteins
  54167 (Icos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 Ig_2 SKG6
Motif
Other DBs
NCBI-GeneID: 54167
NCBI-ProteinID: NP_059508
MGI: 1858745
Ensembl: ENSMUSG00000026009
Vega: OTTMUSG00000002307
UniProt: Q9WVS0 Q5SUZ7 Q3V3X2
Position
1 C2; 1 30.6 cM
AA seq 200 aa AA seqDB search
MKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFRERE
VLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQ
ERNLSGGYLHIYESQLCCQLKLWLPVGCAAFVVVLLFGCILIIWFSKKKYGSSVHDPNSE
YMFMAAVNTNKKSRLAGVTS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtacttctgccgtgtctttgtcttctgcttcctaatcagacttttaacagga
gaaatcaatggctcggccgatcataggatgttttcatttcacaatggaggtgtacagatt
tcttgtaaataccctgagactgtccagcagttaaaaatgcgattgttcagagagagagaa
gtcctctgcgaactcaccaagaccaagggaagcggaaatgcggtgtccatcaagaatcca
atgctctgtctatatcatctgtcaaacaacagcgtctcttttttcctaaacaacccagac
agctcccagggaagctattacttctgcagcctgtccatttttgacccacctccttttcaa
gaaaggaaccttagtggaggatatttgcatatttatgaatcccagctctgctgccagctg
aagctctggctacccgtagggtgtgcagctttcgttgtggtactcctttttggatgcata
cttatcatctggttttcaaaaaagaaatacggatccagtgtgcatgaccctaatagtgaa
tacatgttcatggcggcagtcaacacaaacaaaaagtctagacttgcaggtgtgacctca
taa

DBGET integrated database retrieval system