KEGG   Mus musculus (mouse): 54192Help
Entry
54192             CDS       T01002                                 

Gene name
Pbsn, PB, Prbs
Definition
(RefSeq) probasin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin DUF1128
Motif
Other DBs
NCBI-GeneID: 54192
NCBI-ProteinID: NP_059499
MGI: 1860484
Ensembl: ENSMUSG00000000003
Vega: OTTMUSG00000017891
UniProt: O08976 Q3UV89
Position
X; X B
AA seq 174 aa AA seqDB search
MMRVIILLLTLHVLGVSSVMSLKKKIDGPWQTIYLAASTMEKINEGSPLRTYFRHILCGR
RCNQVYLYFFIKKGTKCQLYKVIGRKKQEVYYAQYEGSIAFMLKMVNEKILLFHYFNKNR
RNDVTRVAGVLAKGKQLNKEEMTEFMNLVEEMGIEEENVQRIMDTDNCPSKIKP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggtcatcatcctcctgctcacactgcatgtgctaggcgtctccagtgtgatg
agtctcaaaaagaagattgacgggccttggcaaacaatttacttagctgccagtaccatg
gaaaagataaatgaaggctcaccattgagaacctacttccgtcacattttgtgtgggagg
agatgcaaccaagtctacctctatttttttattaagaaagggactaagtgccaactgtat
aaagtcataggaaggaaaaaacaagaagtttactatgcacagtatgaagggagcatagca
ttcatgttaaagatggtaaatgagaagatattgttgtttcattattttaacaagaacaga
agaaatgatgtcacacgagtggctggagttttggcaaaaggcaaacaactgaataaggag
gagatgacggagttcatgaacttagtggaagaaatgggcattgaggaagagaatgtacag
cgtatcatggacacggacaactgtccaagcaagatcaaaccttag

DBGET integrated database retrieval system