KEGG   Mus musculus (mouse): 54195
Entry
54195             CDS       T01002                                 

Symbol
Gucy1b1, GC-S-beta-1, GCbeta1, Gucy1b3
Name
(RefSeq) guanylate cyclase 1, soluble, beta 1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04730  Long-term depression
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    54195 (Gucy1b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    54195 (Gucy1b1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    54195 (Gucy1b1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    54195 (Gucy1b1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    54195 (Gucy1b1)
   04924 Renin secretion
    54195 (Gucy1b1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    54195 (Gucy1b1)
  09154 Digestive system
   04970 Salivary secretion
    54195 (Gucy1b1)
  09156 Nervous system
   04730 Long-term depression
    54195 (Gucy1b1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    54195 (Gucy1b1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     54195 (Gucy1b1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 54195
NCBI-ProteinID: NP_059497
MGI: 1860604
Ensembl: ENSMUSG00000028005
Vega: OTTMUSG00000051753
UniProt: O54865 Q80YP4 Q3UTI4
Position
3; 3 E3
AA seq 620 aa
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPLFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETNEEDEN
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgtacggtttcgtgaaccatgccctggagctgctggtgatccgcaattatggtcccgag
gtgtgggaagacatcaaaaaagaggcacagctggatgaagaaggccagtttcttgtcaga
ataatatacgatgattccaaaacatatgacctggtggctgctgcaagcaaagtcctcaac
ctcaatgctggcgaaatcctgcagatgtttgggaagatgtttttcgtcttctgccaggag
tctggctatgataccatcttgcgtgtcctgggatctaatgtcagagagtttttgcagaac
ctcgatgccctgcatgaccacctcgccaccatttacccagggatgcgcgcgccttccttc
aggtgcaccgatgcggagaaaggcaaagggctcatcctgcactactactcggaaagagag
gggcttcaggacatcgtgatcgggattatcaagactgttgctcaacagatacacggcact
gagatagacatgaaggtgattcagcaaagaaatgaagaatgtgatcacacccagttttta
attgaagaaaaggaatcaaaagaagaggatttttatgaagatctggataggtttgaagag
aatggtacccaggaatcacgtatcagcccttacaccttctgcaaagcatttccttttcac
atcatatttgaccggaacctagtggtcactcagtgtggcaatgccatctacagagtgctc
ccccagctccagcctgggaactgcagccttctgtctgtcttctctctggtccgccctcac
atcgacatcagtttccatgggattctttcacacatcaatacagtctttgtactgagaagc
aaggaagggttgctggatgtggagaaacttgagtgtgaggatgaactgactggagcagag
attagctgcttacgtctcaaaggccaaatgatctacttaccagaagcagatagcatcctc
ttcctctgttcaccaagtgtgatgaacctggacgacctaacaagaagaggcctgtatctg
agtgacatccctctccacgatgctacccgagacctggttcttttgggagaacagttccgg
gaggagtacaaactgacacaagagctggaaatcctcaccgacaggctgcagctcacactg
agagccttggaggatgagaagaaaaagacagacacattgctgtattctgtccttcctcca
tctgttgccaatgagctgagacacaagcgcccagtgcctgccaaaagatacgacaatgtg
accatcctcttcagcggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggggccatgaagattgtcaatctcctcaacgatctctacacccgatttgacacactg
actgattcacgaaaaaacccatttgtttacaaggtggaaacagttggtgacaagtatatg
acagtgagtggcttgccagaaccttgtatccaccatgcacggtccatttgccacctggct
ttagacatgatggaaattgctggtcaagttcaagtagatggtgaatctgttcagataaca
atcgggatccataccggggaggtggtgacaggtgtgattggacagcggatgcctcggtat
tgtctctttgggaataccgtcaacctcacaagcaggacagaaaccacaggagaaaaggga
aagataaatgtttccgaatatacatacaggtgtctcatgtctccagaaaactcggatcca
ctgttccatttggagcacagaggcccagtgtctatgaagggcaagaaggaaccaatgcaa
gtctggttcctatccaggaaaaatacaggcacggaggaaacaaatgaggaggatgaaaac
tga

DBGET integrated database retrieval system