KEGG   Mus musculus (mouse): 54208
Entry
54208             CDS       T01002                                 

Gene name
Arl6ip1, AIP-6, AL022945, ARMER, AU042858, Aip-1, Arl6ip, C85138, mKIAA0069
Definition
(RefSeq) ADP-ribosylation factor-like 6 interacting protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Reticulon TraG_N
Other DBs
NCBI-GeneID: 54208
NCBI-ProteinID: NP_062292
MGI: 1858943
Ensembl: ENSMUSG00000030654
Vega: OTTMUSG00000057156
UniProt: Q9JKW0 Q80ZW9
Position
7; 7 F1
AA seq 203 aa
MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIY
YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV
GWWKRLFSLKEEKPKMYFMTMIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGII
LKYIGMAKREINKLLKQKEKKNE
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggagggggataaccgcagcagcaacctgctggccgtggagactgcaagtcttgaa
gagcagctgcaaggctggggagaggtgatgctgatggctgacaaagtccttcgatgggaa
agagcctggtttccacctgccatcatgggtgtggtttccctgctgttcctgattatctat
tatctcgatccatctgtgctgtctggtgtttcctgctttgttatgtttttgtgcctggct
gactaccttgttcccattctagcaccaagaatttttggctctaataaatggaccactgaa
caacagcaaagatttcatgaaatctgcagtaatctagtaaaaactcgacgcagagctgtg
ggctggtggaaacgcctcttttccctaaaggaagaaaagcctaaaatgtacttcatgacc
atgatcatttctcttgctgcggtggcttgggtgggacagcaagttcacaacctgcttctc
acctacctgattgtgacatttgtgctgttgcttcctggactaaaccaacatgggatcatt
ctgaagtacattggaatggccaaaagggagataaacaaacttctcaagcaaaaagaaaag
aaaaatgagtag

DBGET integrated database retrieval system