KEGG   Mus musculus (mouse): 54215
Entry
54215             CDS       T01002                                 

Symbol
Cd160, AU045688, By55
Name
(RefSeq) CD160 antigen
  KO
K06542  CD160 antigen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    54215 (Cd160)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    54215 (Cd160)
CD molecules [BR:mmu04090]
 Proteins
  54215 (Cd160)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  54215 (Cd160)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 54215
NCBI-ProteinID: NP_001156968
MGI: 1860383
Ensembl: ENSMUSG00000038304
Vega: OTTMUSG00000022013
UniProt: O88875
Position
3; 3 F2.1
AA seq 185 aa
MQRILMAPGQSCCALAILLAIVNFQHGGCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLI
LFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQ
KPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSSGFLQVKAWGMLVTSLVALQ
ALYTL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcaaagaatcctgatggcccctggccaaagctgctgtgccctggccatcctgctggca
attgtgaacttccaacatggtggatgtattcatgtcaccagctcagcatcccagaaagga
gggcgactggacctcacctgtactttgtggcacaagaaagacgaagctgaggggctaata
ctcttctggtgcaaagacaatccttggaactgttcccctgagaccaacttagaacagctt
agggttaaaagggatcctgagacagatggcatcactgaaaagtcatctcagttggtgttc
accatagaacaagctacaccatcagacagtgggacctaccagtgctgtgccagaagccag
aaaccagaaatctacattcatggccactttctctccgttctagtcacagggaaccacaca
gagataagacagagacaaaggtcacaccctgacttcagccatatcaacggcactctcagt
tcaggcttcctgcaagtaaaggcttgggggatgttggtcaccagcctggtggcccttcaa
gctctatataccttgtga

DBGET integrated database retrieval system