KEGG   Mus musculus (mouse): 54343
Entry
54343             CDS       T01002                                 

Gene name
Atf7ip, 2610204M12Rik, 5830415B17Rik, A, AM, Mcaf, Mcaf1
Definition
(RefSeq) activating transcription factor 7 interacting protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ATF7IP_BD fn3_4
Other DBs
NCBI-GeneID: 54343
NCBI-ProteinID: NP_062299
MGI: 1858965
Ensembl: ENSMUSG00000030213
Vega: OTTMUSG00000047948
UniProt: Q7TT18
Position
6; 6 G1
AA seq 1306 aa
MDSVEEPQKKVFKARKTMRASDRQQLDAVHRVKGELLRADGKLLNGSHENGDLDPTSPLE
NTDCIQDREEVNGIDGICFQSEESTTEWKETPCMPNVAVKNKQEDLNSEALSPSITCDLS
SRVTTEPGSGSPASDNPGCGTPVSDNPASDNPASDNPASDNPDSGDLAAGELATTVQATG
DSACEEPPSSDPSSSDPTSSEPSSSEPTCSEPISGDPVSEEAASHDLVSGDSTCSEPVSG
EPVSHEAASSEPATSEPASDEPVARVVAACELAPGESALDDCAPSGDSQSDEPPSSEDSL
PRSVCSGLASGELTPGELSVEPATDTVKPSSSAVCEAGPDPDKTEPSSNNSDDCPGKSED
DEHLDQIQSKDSCDEGNKVNSNVVEKEEPLETHSAIICSDLPPENTTKIAEDPIAEPALE
EEAISSSMEVDQSEKDEHKSPAEPVAAVSEDPAEEDKEDTVVDNTDSMETDEIIPILEKL
APTEDELSCFSKASLLPVETSQDLEDKMEGSFGSPSKQESSENLPKEAFLVLSDEEDLSC
GKDESEAVAQSKMSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVE
SKRRRYMDEEYEAEFQVKITAKGDINQKLQKVIQWLLQEKLCALQCAVFDKTLAELKTRV
EKIECNKRHKAVLTELQAKIARLTKRFGAAKDDLKKRQESPPNPPISPGKPANDTNSNNN
MTYRNAGTVRQLLESKRNVSEGPPPSFQTPVNTVSSASHATSTAVVSSQPKLQTSATSGS
LPAAPLLPAPSTATVVATTQVPSGTPQPTISLQPLPVILHVPVAVTSQPQLLQSHPGTLV
TNQPSGNVEFISVQSQPTVSGLTKNPVSLPPLPNPTKPNIPSVPSPSSIQRNSSTTAAPL
GTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSSSSSRGPIQMKIPISTFSPPSSAEQNS
SATPRIVTENQTNKTVDSSINKKAADSTSQSGKASSSDSSGVIDLTMDDEESGTTQDPKK
ISPPSSSTVSTSQPMSRPLQPILPAPPLQPSGVPTSGPSQATIHVLPTAPTTVNVTHRPV
TQVTTRLPVPRAPANHQVVYTTLPAPTTQAPLRGTVMQAPAVRQVNPQNSVTVRVPQTTT
YVVNNGLTLGSAGPQLTVHHRPPQVHNEPPRPLHPAPLPEAPQPQRLPPEAASTSLPQKP
HLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLYAYHEEPSATVPSQWKKIGEVKALPL
PMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQSTDVISSSQNS
NT seq 3921 nt   +upstreamnt  +downstreamnt
atggatagtgtagaagaacctcagaaaaaagtcttcaaggctcggaaaacaatgagagcg
agcgatcgccagcagctcgatgctgtgcacagagtcaagggggagctgctgagagccgac
gggaagctgctgaacgggagccatgagaatggagacttggatcccacttcacccttggaa
aacacagattgtattcaagatcgagaagaagtgaatggtattgatgggatttgttttcag
tcagaagaaagtacaacggaatggaaagagaccccttgtatgcccaatgttgctgtaaaa
aacaaacaagaagatttgaatagtgaagctttgtcccccagtataacttgtgatctttct
tctagagtaaccactgaaccaggttctggtagtccagcctctgataacccaggctgtggt
accccagtctctgataacccagcctccgataacccagcctctgacaacccagcctctgac
aacccagactctggtgatctggctgcaggagagctggccactacagtacaggctactggt
gactctgcctgtgaggagcctccctccagtgatccctcttccagtgatcccacttccagt
gagccctcttccagtgagcccacctgtagtgagcccatctctggagatcctgtttctgaa
gaagccgcctctcatgatcttgtctctggtgattccacttgtagcgagccagtttctggt
gagccggtgtctcatgaagcagcttcgagtgagccagctacaagtgagccagcttcagat
gaaccggtcgcaagggtcgtggcggcctgcgaactggctcctggggagtcagccttggat
gattgtgccccctccggtgattcacagtctgatgagccaccttctagtgaggactccctt
cctaggtctgtctgcagcggactggcttctggtgagctgactcctggggagctctctgtg
gaaccagccaccgacactgttaaaccaagctcatcggcagtttgtgaagcaggtcctgac
cctgacaagacagagccgagtagcaataacagtgatgattgtccaggcaagagtgaagac
gacgaacacttagaccaaattcaaagtaaagactcctgtgatgagggaaataaagtgaac
agtaatgtcgtcgagaaggaagaacctctcgaaacacacagtgcaattatttgttctgat
ctacctccagaaaacacaacgaagatagcggaggatcccatcgctgagcctgctctcgag
gaagaggccatctccagcagcatggaagttgaccaaagcgaaaaggatgagcataaaagt
cctgcagaacctgtagccgctgtcagtgaggaccccgccgaggaggacaaggaggatact
gtcgtagacaacacggactccatggaaacagatgagatcattccgattttggaaaaactc
gcacccaccgaggatgaactcagttgcttttcaaaagcttctctccttccagtcgaaaca
agtcaagatttggaggataaaatggagggctctttcggctcaccctcgaaacaagaaagt
agtgagaatttgccaaaagaagcctttttagtcctttctgatgaagaggatctttcgtgt
ggaaaagatgagtccgaagctgtagcgcagagtaagatgagcaccccagagggagaaaag
agtgagaaggacggcaaagctgaggaagaggagcgagttccagccgaggagcagccacct
gtgagaaatgagttttctagacgaaaacgttctaagtcagaagacatggacagtgtagag
tccaaacgccggcgatatatggatgaagaatacgaggctgagtttcaagtaaagatcaca
gctaaaggtgacatcaaccagaagcttcaaaaggtcatacagtggttgctacaagaaaaa
ctgtgtgccctacagtgtgctgtgtttgataagacgttggcagaattaaaaactcgagtg
gagaagatagagtgcaacaagaggcataaggcagtgctcaccgagctgcaggccaagata
gccaggttaaccaaacgttttggagcagccaaagatgatcttaagaaaagacaagaaagc
cctccaaacccacccatatcaccaggaaagcctgccaatgacaccaacagcaataataat
atgacctacagaaatgcaggcacagtgcgacaactgctggagtccaaaagaaatgttagc
gagggtccaccaccatcctttcaaactcctgtgaatacagtgtcttcagccagtcacgcc
acttctacagcagttgtcagtagtcagcctaaactgcagacctcagcaacctcgggctct
ctgccggcggcacctcttcttcctgcgcccagcacagccaccgtagttgccactactcag
gtgcctagtgggacccctcagcctacaatctctctgcagcccttgccagtgatcctgcat
gtgcccgttgccgtgacctctcagcctcagctcctgcaaagtcatccagggactttagtg
accaatcaaccatctggcaacgtggagttcatatctgtgcaaagccaacctacagtgagt
ggtcttaccaaaaatccagtatccttgccacccttgccaaaccccactaaaccaaacatt
ccgtcagtgcccagtcctagtagtattcagaggaactcttcaaccaccgccgcaccgttg
ggaacaacccttgctgtccaggccgttccaaccgcacattctattgtgcaggccacaagg
acttctctacccacagtaggcccgtcaggactctatagctcttcaagcagtcgaggccca
atacagatgaaaatcccaatatccacttttagccctccatcttcagcagaacaaaatagc
tctgccaccccaagaattgttacagaaaaccagacaaacaaaacagtagattcttctatt
aataagaaagcagccgatagcacatcacagagtggaaaagcttctagcagtgactcaagt
ggtgtcattgatctcacgatggacgatgaagagagcggaactacacaagaccccaagaag
ataagtcctccttcttcatcaactgtgagcacttctcagcccatgtctcgaccgttgcag
cccattctgccagcaccacctcttcagccatcaggcgtgcccacaagtggaccatctcag
gcaactatccatgttctgcctacagctccaaccaccgtgaatgtaacacatcgtccagta
actcaggtgaccacaagactccctgtaccgagagctcctgcaaaccaccaagtggtttat
acaactctcccagcgccaaccactcaggctcccctacgaggaactgttatgcaggctcct
gccgttcgccaggtcaatcctcaaaatagtgttacagttcgagtgcctcagacaaccaca
tatgttgtaaacaatggactgactctaggctcagcagggcctcagctcacggtgcatcac
aggcccccacaagtgcacaatgagcccccacgccctctgcatccagcgcccttaccagaa
gccccacagccccagcgtctgcccccggaagctgccagcacttctctgcctcagaaacca
cacttgaagttagcacgagttcagagtcagaatggcattgttctgtcgtggagcgtcctg
gaagtggaccgaagctgtgctactgttgacagctaccatctctatgcttaccacgaggag
cccagtgccaccgtgccctcacagtggaagaagatcggggaagtcaaggccctgcccttg
cccatggcttgcactctcacgcagtttgtgtctggcagcaagtactactttgcagtgcgc
gccaaggacatttatggccgctttgggcctttctgtgacccacagtccacggacgtgatc
tcttcctcccagaacagttag

DBGET integrated database retrieval system