KEGG   Mus musculus (mouse): 54351
Entry
54351             CDS       T01002                                 

Gene name
Elp5, Derp6, Ra, Rai12
Definition
(RefSeq) elongator acetyltransferase complex subunit 5
  KO
K11376  elongator complex protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    54351 (Elp5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    54351 (Elp5)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Elongator complex
    54351 (Elp5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    Elongator complex
     54351 (Elp5)
SSDB
Motif
Pfam: Elong_Iki1
Other DBs
NCBI-GeneID: 54351
NCBI-ProteinID: NP_061210
MGI: 1859017
Ensembl: ENSMUSG00000018565
Vega: OTTMUSG00000006030
UniProt: Q99L85
Position
11; 11 B3
AA seq 300 aa
MLDSLLAIGGLVLLRDSVEWEGRSLLKALIKKSALRGEQVHVLGCEVSEEEFREGFDSDV
NSRLVYHDLFRDPLNWSKPGEAVPEGPLKALRSMCKRTDHGSVTIALDSLSWLLCHIPCV
TLCQALHALSQQNGDPGDNSLVEQVRVLGLLHEELHGPGSMGALNTLAHTEVTLSGKVDQ
TSASILCRRPQQRATYQTWWFSVLPDFSLTLHEGLPLRSELHPDHHTTQVDPTAHLTFNL
HLSKKEREARDSLTLPFQFSSEKQKALLHPVPSRTTGHIFYEPDAFDDVDPEDPDDDLDI
NT seq 903 nt   +upstreamnt  +downstreamnt
atgctggactcgttgttggccatcggtggtttggtgcttttgcgagattccgtggagtgg
gaagggcgtagtctcctgaaggctcttatcaagaaatctgcacttcgtggggagcaggtc
cacgttctgggctgtgaagtgagcgaagaagagtttcgcgaaggtttcgactctgatgtc
aacagccgcctggtttaccatgacctcttcagagaccctcttaactggtcaaagcctgga
gaagctgtccctgaaggtcctctaaaagccttgaggtccatgtgcaaaaggacagaccat
ggctcagtcaccattgcccttgactctctcagctggctgctgtgtcacattccctgtgtt
acactctgtcaagccctacatgctctgagccagcaaaatggagacccaggtgataactcc
ctagtagagcaggtgcgtgtcctgggcctcctacatgaagagcttcatggcccaggctcc
atgggagcactgaacacccttgctcacacagaggtgactctgagtggtaaagtggaccag
acctcagcctccatcctctgtcgaaggccccaacaacgtgcaacttaccagacttggtgg
ttctccgttcttcctgacttcagcctgactctccatgaagggcttcccctccgttctgag
ctacacccggatcatcacacaacccaggtggatcccactgctcatttgacctttaacctt
cacttatccaagaaagaaagagaagccagagacagcctcactctgcctttccagttcagc
tctgaaaaacagaaagctctgctgcatccggtacccagccggaccactggccacatcttc
tatgagccagatgcttttgatgatgtggacccagaagacccagatgatgacctagatatt
tga

DBGET integrated database retrieval system