KEGG   Mus musculus (house mouse): 54353
Entry
54353             CDS       T01002                                 
Symbol
Skap2, 2610021A10Rik, AA960083, BB137539, RA70, SKAP-HOM, Saps, Scap2, mSKAP55R
Name
(RefSeq) src family associated phosphoprotein 2
  KO
K23471  src kinase-associated phosphoprotein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    54353 (Skap2)
SSDB
Motif
Pfam: PH SH3_1 SH3_9 SH3_2 PH_11 PH_9 PH_13 PH_20
Other DBs
NCBI-GeneID: 54353
NCBI-ProteinID: NP_061243
MGI: 1889206
Ensembl: ENSMUSG00000059182
UniProt: Q3UND0
Structure
Position
6:complement(51836145..51989529)
AA seq 358 aa
MPNPSCTSSPGPLPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYL
QEFQDKGDAEDGDEYDDPFAGPADTISLASERYDKDDDGPSDGNQFPPIAAQDLPFVIKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKD
GKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLGSDVIPEDDEERGELYDDV
DHPAAVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKGSRDSVHHTSGDKSTDYANF
YQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYLMEMYDI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccaaccccagctgtacctcttctcccggccctctccctgaggaaattaggaacctg
ttggcagatgttgaaacatttgtggcagacacactgaaaggagaaaatttatccaagaaa
gccaaggaaaagagagaatctctcattaagaagataaaagatgtaaagtctgtctatctt
caggaatttcaagacaaaggtgatgctgaggacggcgatgaatatgacgatccctttgct
gggcctgcagacacgatttccttagcctcagagcgctacgataaagatgatgatggcccc
tctgatggaaaccagtttcctcccattgcagcccaggaccttccttttgtcataaaggct
ggctacctggaaaaacgcagaaaagatcacagctttctggggtttgaatggcagaaacgg
tggtgtgcgctcagcaaaacagtgttctattattacgggagcgataaagacaagcaacag
aaaggtgaatttgcaatagatggctatgatgtcagaatgaacaacacccttaggaaggat
ggaaagaaagattgctgttttgaaatctgtgctcccgacaaacgtatctatcagtttaca
gcagcctctcccaaagatgctgaggaatgggtccagcagctgaaatttatactacaagac
ctgggatccgacgttattcctgaggatgatgaggaaagaggagaattatatgatgacgtt
gaccatcctgctgccgtcagcagcccgcagaggagccagccaatcgatgatgagatttat
gaggagctcccagaggaggaagaggacactgcttcagtgaagatggacgagcaagggaag
ggaagtcgggacagtgtgcatcacacctcaggagataaaagcactgattacgctaatttt
taccagggtctgtgggactgcactggagctctgtctgatgagttgtcctttaagcgtggt
gatgtgatttacattcttagcaaggaatacaatagatatggctggtgggtaggagagatg
aagggagccattggcttggtgcctaaagcctacctaatggagatgtatgatatttga

DBGET integrated database retrieval system