KEGG   Mus musculus (house mouse): 54364
Entry
54364             CDS       T01002                                 
Symbol
Rpp30, Rnasep2, TSG15
Name
(RefSeq) ribonuclease P/MRP 30 subunit
  KO
K03539  ribonuclease P/MRP protein subunit RPP1 [EC:3.1.26.5]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    54364 (Rpp30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    54364 (Rpp30)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    54364 (Rpp30)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    54364 (Rpp30)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     54364 (Rpp30)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     54364 (Rpp30)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    54364 (Rpp30)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    54364 (Rpp30)
SSDB
Motif
Pfam: RNase_P_p30
Other DBs
NCBI-GeneID: 54364
NCBI-ProteinID: NP_062301
MGI: 1859683
Ensembl: ENSMUSG00000024800
UniProt: O88796 Q3TF81
Position
19:36061089..36082173
AA seq 268 aa
MAAFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKREIEKPIAVSELFTT
LPIVQGKSRPIKILTRLTIIVTDPAHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPVNVAIERGLGFELVYGPAIRDATMRRYTISNALNLMQIC
KGKNVILSSAAERPLEIRGPYDVANLGLLFGLSENDGKAAVSTNCRAVFLHGETRKTAFG
IISTVKKPRPSEADDESLPVCKKAKCEG
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcggcgttcgcagatttggatttaagagcgggctcagacctgaaggctctgcgcgga
ctcgtggagactgctgctcacctgggatactcagttgttgccatcaatcacattgttgac
tttaaggaaaagaaacgggaaattgaaaagccaatagcagtttctgaactcttcacaact
ttacccatcgtacagggaaaatcaagaccaattaaaattttaactagattgacaattata
gttacagatccagctcactgtaatgttttgagagcaacttcgtcaagggtccggctgtat
gatattgttgcagtctttccaaagacagaaaagcttttccatgttgcttgtacacattta
gatgtggatttagtctgtataactgtaacagagaaattaccattttacttcaaaagaccc
cctgttaatgtggcaattgagcgaggcctgggctttgaacttgtctatggtcctgctatc
agagatgcaacgatgagaaggtacacaatctccaatgccctcaatttgatgcagatctgc
aaaggaaagaatgtaattctgtccagtgctgcagaaaggcctttggaaataagaggacca
tatgacgtggcaaacttaggactgctgtttgggctttctgaaaatgatggcaaggctgcc
gtgtccacaaattgcagagctgtatttctccatggagaaactagaaaaactgcttttgga
attatttctacagtgaagaaaccacggccatcagaagcagatgatgaatctcttccagtg
tgcaagaaagctaaatgtgagggctga

DBGET integrated database retrieval system