KEGG   Mus musculus (mouse): 54368
Entry
54368             CDS       T01002                                 

Gene name
Gp9, Cd42, GP, GPIX
Definition
(RefSeq) glycoprotein 9 (platelet)
  KO
K06263  platelet glycoprotein IX
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    54368 (Gp9)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    54368 (Gp9)
   04611 Platelet activation
    54368 (Gp9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    54368 (Gp9)
CD molecules [BR:mmu04090]
 Proteins
  54368 (Gp9)
SSDB
Motif
Pfam: LRRNT LRR_8 LRRCT LRR_4
Other DBs
NCBI-GeneID: 54368
NCBI-ProteinID: NP_061232
MGI: 1860137
Ensembl: ENSMUSG00000030054
Vega: OTTMUSG00000057257
UniProt: O88186
Position
6 D1; 6 39.13 cM
AA seq 177 aa
MTTWGLLFLLWPATTDTQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLAN
NSLRSVPPGAFDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMHVYCASPDLAT
RRPLGQLTGYELGSCGWKLPPSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN
NT seq 534 nt   +upstreamnt  +downstreamnt
atgactacctggggcctcctgtttctgctctggcctgcgaccacagatactcaggcttgc
cccaggccctgtacctgccagtccttggaaaccatggggttaaaggtgaactgtgagggg
caaggcctcacagccctgcccgtgataccagcgcacactcgccagctcctgctggccaac
aatagcctgcgttcagtgccaccaggtgccttcgaccacttgcctcagctgtgggacctg
gatgtgacacacaacccctggcactgtgactgcagcctcacctacctgcgcctctggctg
gaggaccacatgcccgaggccctaatgcatgtgtactgtgccagccctgacttggccacc
aggcgcccgctgggccagctgacaggttatgagctgggcagctgtggctggaagctgcca
ccatcctgggcctatccaggggtgtggtgggatgtgtcactagtggctgtggctgtgctg
ggcctgattctgctggctggtctattgaacacatttacagagtccaggaactga

DBGET integrated database retrieval system