KEGG   Mus musculus (mouse): 54369
Entry
54369             CDS       T01002                                 

Gene name
Nme6, nm23-M, nm23-M6
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mmu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mmu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    54369 (Nme6)
   00240 Pyrimidine metabolism
    54369 (Nme6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    54369 (Nme6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54369 (Nme6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     54369 (Nme6)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    54369 (Nme6)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 54369
NCBI-ProteinID: NP_061227
MGI: 1861676
Ensembl: ENSMUSG00000032478
Vega: OTTMUSG00000030951
UniProt: O88425
Position
9; 9 F2
AA seq 189 aa
MTSILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFY
REHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAET
GGHKQPNKT
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacctccatcttgcgaagtccccaagctcttcagctcacactagccctgatcaagcct
gatgcagttgcccacccactgatcctggaggctgttcatcagcagattctgagcaacaag
ttcctcattgtacgaacgagggaactgcagtggaagctggaggactgccggaggttttac
cgagagcatgaagggcgttttttctatcagcggctggtggagttcatgacaagtgggcca
atccgagcctatatccttgcccacaaagatgccatccaactttggaggacactgatggga
cccaccagagtatttcgagcacgctatatagccccagattcaattcgtggaagtttgggc
ctcactgacacccgaaatactacccatggctcagactccgtggtttccgccagcagagag
attgcagccttcttccctgacttcagtgaacagcgctggtatgaggaggaggaaccccag
ctgcggtgtggtcctgtgcactacagtccagaggaaggtatccactgtgcagctgaaaca
ggaggccacaaacaacctaacaaaacctag

DBGET integrated database retrieval system