KEGG   Mus musculus (mouse): 54377
Entry
54377             CDS       T01002                                 

Gene name
Cacng4, AI413107, AW491861
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 4
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54377 (Cacng4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    54377 (Cacng4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    54377 (Cacng4)
   04261 Adrenergic signaling in cardiomyocytes
    54377 (Cacng4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    54377 (Cacng4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    54377 (Cacng4)
   05414 Dilated cardiomyopathy
    54377 (Cacng4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    54377 (Cacng4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   54377 (Cacng4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269
Other DBs
NCBI-GeneID: 54377
NCBI-ProteinID: NP_062304
MGI: 1859167
Ensembl: ENSMUSG00000020723
Vega: OTTMUSG00000003107
UniProt: Q9JJV4 A2AAU2
Position
11; 11 E1
AA seq 327 aa
MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGD
LTHSGLWRVCCIEGIYRGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
GGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRR
RRSRSSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQDAGF
LQMHDFFQQDLKEGFHVSMLNRRTTPV
NT seq 984 nt   +upstreamnt  +downstreamnt
atggtgcgatgcgaccgcgggctgcagatgctgctgaccacggccggagccttcgccgcc
ttctcgctcatggccatcgccatcggcaccgactactggctgtactccagcgcgcacatc
tgcaacggcaccaacctgaccatggacgacgggcccccgccccgccgcgctcgcggcgac
ctcacccattcgggactgtggcgggtgtgttgcatcgaaggcatctatagagggcactgc
ttccggatcaaccacttcccagaggacaatgattacgaccacgacagctccgagtacctc
ctccgcattgtgcgagcctccagtgtctttcccatcctcagcaccattctgctcctgctc
ggagggctctgcatcggcgctgggaggatctacagccgcaagaacaatattgtcctcagc
gcgggaatcctctttgtggcggcaggcctcagtaatatcatcggtatcatcgtctacatt
tccagcaacacgggcgaccccagtgacaaacgtgacgaagacaaaaagaaccattacaac
tacggctggtctttttactttggagccctgtcgtttattgtggcggagaccgtgggcgtc
ctggctgtaaacatttacattgagaaaaataaagagttgaggtttaagaccaagcgggag
ttccttaaggcctcttcctcctctccttacgccaggatgccgagctacaggtaccggcga
cggcggtccaggtccagttcaaggtccacggaggcctcaccctccagggatgcatctccc
gtgggcctgaagatcaccggagccattcccatgggtgagctgtccatgtacacgctatcc
agagaaccccttaaggtgaccacagctgcgagctacagtccggaccaggacgctggcttc
ctgcagatgcatgacttcttccaacaggacctaaaggaaggtttccatgtcagcatgctg
aaccggcggacgactcccgtgtga

DBGET integrated database retrieval system