KEGG   Mus musculus (mouse): 54384
Entry
54384             CDS       T01002                                 

Gene name
Mtmr7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    54384 (Mtmr7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    54384 (Mtmr7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    54384 (Mtmr7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     54384 (Mtmr7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     54384 (Mtmr7)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    54384 (Mtmr7)
SSDB
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 CCDC53
Other DBs
NCBI-GeneID: 54384
NCBI-ProteinID: NP_001035789
MGI: 1891693
Ensembl: ENSMUSG00000039431
Vega: OTTMUSG00000038176
UniProt: Q9Z2C9
Position
8; 8 A4
AA seq 660 aa
MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPVKYEELYCFSFNPKLDK
EEREQGWLLVDLSEEYKRMGLPDNYWQLSDVNRDYRVCDSYPTELYVPRSATAHIIVGSS
KFRSRRRFPALSYYCKDSHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPYY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLTEQFPCAFEFN
ERFLTHIQHHVYSCQFGNFLCNSQKERRELKIQERTYSLWSNLWKNRADYLNPLFRADHS
QTQGSLHLPTAPCNFTYKFWNGMYNRFEKGLQPRQSVTDYLMAVKEESQQLEEELESLEE
RLEKIQKVHLHGTKVKSKQSEPSKHSGFSTSDHSTANTPQDYSGNSKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSVNSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggagcacatccgcacgcccaaggttgaaaacgtgcgcttggtagacagagtgtcttgt
aaaaaggcagcgctgggaactttgtatctgacggccactcacgtcatattcgtggaaaat
gcacctgacacaagaaaagaaacctggattctgcacagtcagatctccaccattgaaaag
caggcgacaacagctacgggctgccctctgcttattcgctgcaagaacttccagatcgta
caacttgtcattccacaggagagagactgccacgacgtgtacatctctctgatacgcctt
gcacggccagtgaagtacgaggagctatactgcttttccttcaaccccaagctggataag
gaagaacgggagcagggctggttgctggttgaccttagtgaagaatacaagcgaatgggc
ctccctgataattattggcagctcagcgatgtgaatagagactacagagtttgtgactct
taccccacggaactgtacgtccccagatcggccacggcacacatcatcgtgggcagctcc
aagttccggagcagacggcgatttcctgccctttcctactactgtaaagacagccatgcc
tccatctgcaggagcagccagcccctttccggcttcagcgctcggtgcctggaggatgag
cagatgctccaagccatcaggaaagccaatcctggaagtgacttcatttatgtcgtggac
acaaggcctaaacttaatgcgatggcaaatcgtgctgcagggaaaggctatgagaatgaa
gacaattattccaatatcaagtttcagtttatcggcatagagaacatccacgtcatgagg
aacagtcttcagaaaatgctggaagtgtgtgaacttaaatctccctctatgagtgatttc
ctgtggggactggagaactcaggctggctgaggcacatcaaagccatcatggatgcaggg
atcttcattgcaaaggcagtttcagaggaaggggcaagtgtgcttgttcactgttctgac
ggctgggacagaacggcccaggtgtgctcggtggctagcctgctgctggacccttactac
cggactctgaaaggattcatggtattaattgaaaaggactggatttccttcggacataaa
tttaatcatagatatggcaacttagatggtgacccaaaagaaatctctccagtaatcgac
cagttcattgagtgtgtctggcagctaacggaacagttcccttgcgcctttgagttcaac
gagaggtttctgactcacattcagcatcatgtttattcctgccagtttgggaacttcctg
tgtaatagccagaaggagaggcgagaactcaagattcaagaaagaacctactctttgtgg
tccaacctgtggaagaatcgagctgactacctcaatcctctgtttagagctgaccacagt
cagacccaggggagccttcatctgcctacagctccatgcaacttcacctataagttttgg
aatgggatgtataaccgctttgaaaaggggttgcagcctcgacagtctgttacagattac
ctcatggctgtgaaggaggagtcccagcagctggaggaagaactggagtccctagaagaa
aggctggaaaaaattcagaaagtccacttacatggtaccaaagtgaagagtaagcaaagt
gagcccagcaaacactcggggttctctacctcagaccacagcacagccaacacccctcag
gattacagtgggaacagcaagtccttcccatccaggagcccgtcccagggtgatgaagat
tctgctctgattctaacccaagacaatttaaaaagctcagaccccgacctctcagtgaat
agtgatcaagagtctggggtggaggatttgagctgtcgatctcccagtggtggtgagcat
gcacccagcgaagacagtggcaaggaccgggactcggacgaagctgtgtttctcactgcc
taa

DBGET integrated database retrieval system