KEGG   Mus musculus (mouse): 54392Help
Entry
54392             CDS       T01002                                 

Gene name
Ncapg, 5730507H05Rik, Hcapg, MFT.M05.13
Definition
(RefSeq) non-SMC condensin I complex, subunit G
  KO
K06678  condensin complex subunit 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    54392 (Ncapg)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    54392 (Ncapg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cnd3 HEAT_2 HEAT HEAT_EZ UVR Cnd1
Motif
Other DBs
NCBI-GeneID: 54392
NCBI-ProteinID: NP_062311
MGI: 1930197
Ensembl: ENSMUSG00000015880
Vega: OTTMUSG00000027810
UniProt: E9PWG6
Position
5; 5 B3
AA seq 1004 aa AA seqDB search
MAAQKKRLSVKEAFQLAQQPHQNQAKLVVALSRTYGAMDDKTAFQEEFIHYLKYAMVVYK
REPAVERVMDFTAKFVTSFHQSDEEEEEEENDGGILNYLFTFLLQSHEANSSAVRFRVCQ
LTNKLLGNMPENAQIDDDLFDKINEAMLIRLKDKIPNVRIQAVLALSRLQDPKDDDCPVV
DAYVNVIENDSNPEVRRAVLSCIAPSAKTLSKIVGRTKDIKDTVRKLAYQVLAEKVHMRA
MSIAQRVLLLQQGLNDRSDAVKQAVQKHLLQGWLRFTEGNILEFLHRLDVENSSDVAVSV
LHSLFSMTPLSELVGICKNDDGRKLIPVETLTPEIALYWCTLCEYLRSKGDEGEEFLEQI
LPEPAVYAEYLLSYIQGFPVVNEEQKGDFTFIGDLMKREFIGQQLILIMKSLDTSEEGGR
KRLLAILQETLILPTTPISLVSLIVERLLHIIRDDNERIQIVTEIISEIRAPIVNVVVDP
SDTRKKELKMAEIKVKLIEAKEALENCIAVQDFDQASKLKEEIKILEDAKINLLKETEQL
EIKEVHTEKNDAETLQKCLVLCYELLKQMSTSTGITATMNGIIESLILPGIISVHPIVRN
LAVLCLGCCGLQNRDFASKHFMLFLQVLQIDDVTIKISALKAIIDQLMMFGIEPFKTQKV
KGVQCEGEEINCHDKQEENDAGETDPAKSVLKLLSDFLDSEVSELRTGAAEGLAKLMFSG
LLVSSRILSRLILLWYNPVTEEDVRLRHCLGVFFPMFAYANRTNQECFEEAFIPTVQTLA
NAPVSSPLAEVDVTNVVELLVDLTRPSRLNPKAKNSQDYQALTVHDNLAIKICNEILTSP
CSPENRVYTKALSLVELSSNVTKDLLLLLDEILEHVTDRTCLRALEKIKSQLGKGGKESD
PGVVTQDVNTTTAVLQNENEYMTPVRDGKGTQTSKSTQGKSKRGCRKAPVSSKTNRRRQI
AGPDSESDHEPPSEMKMRLPRRAKTAALQKSKLNLAEFLNEDTS
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcagaagaagcggctttctgtgaaggaggcgtttcagctggcgcagcagccg
caccagaaccaggcgaagctggtggtggcgctgagccgcacgtacggcgcgatggatgat
aaaacagcttttcaggaggagtttattcattaccttaagtatgctatggtggtatataag
cgtgaacctgccgtggagagggtcatggacttcacagccaagtttgttacttcatttcac
cagtctgatgaggaagaagaggaggaagagaacgatggtggcattttaaattatttgttt
acttttctcttacagtctcatgaagcaaacagcagtgcagtcagatttagagtgtgccag
ctcactaataaactacttgggaatatgccagaaaatgcccaaattgatgatgacttattt
gataagattaatgaagccatgctaattagattgaaagataagattccaaatgtaagaata
caagcagttttggctctttctcgactccaagatcccaaggacgatgattgcccagtagtt
gatgcatatgttaatgtgattgaaaatgattcaaatccagaagttagacgtgcagtgtta
tcttgtattgcaccatcagcaaagactttgtcaaaaattgtaggacgtacaaaggatata
aaggatactgtcagaaagctggcttatcaggtgttagctgaaaaagttcatatgagagct
atgtctattgctcagagagtgctgctgcttcaacaaggtcttaatgacagatcagatgct
gtgaaacaagcagtgcagaagcatcttctccaaggctggttgcgtttcactgaagggaat
attctagagtttcttcatcggttggatgtggaaaattcttctgatgtagcagtctccgtt
ctccattccttattctcaatgactcctctcagtgagctggtgggaatttgtaaaaatgat
gatggcaggaagttgattccagtggaaacattaactcctgaaattgctctgtactggtgc
accctttgtgaatatttgagatcaaagggagatgaaggtgaagagtttttagagcagatt
ttgccagagcctgcagtatatgctgagtacttactgagttacattcagggcttcccagta
gttaatgaagagcagaaaggtgattttaccttcattggagatttgatgaaaagagaattc
ataggtcagcaattaattctaattatgaaatctttggacactagtgaagaaggaggaagg
aaacgactgctggctattttgcaagagactcttattctgcctacaaccccaatatcctta
gtttctttaattgttgagagactcctccacatcatcagagatgataatgaaaggatacag
attgtcacagaaattatctcagagattcgtgcacccattgttaatgttgttgttgatcca
tctgatacaagaaagaaagaactcaagatggctgaaataaaagttaaacttattgaggct
aaagaagctttggaaaattgcattgctgtacaagattttgatcaggcatcaaaattaaaa
gaagaaataaaaatattggaagatgccaaaataaacctgctaaaagagactgagcaactt
gaaattaaagaagtccacacagaaaagaacgatgcggaaacattacagaagtgtcttgtt
ttgtgttacgaattgttgaaacagatgtccacttcaactggaatcactgcaaccatgaat
gggatcattgaatctttgattcttcctggaataataagtgttcatcctatagtaagaaac
ttggctgttttgtgtttgggatgctgtggactacagaatcgggattttgccagtaaacac
tttatgctgttcttacaggttttgcaaatcgatgatgtcacaataaaaataagtgctcta
aaggcaatcattgaccaattgatgatgtttggaattgagccatttaaaacccagaaagtt
aagggcgttcaatgtgaaggtgaagaaataaactgtcatgataagcaagaagaaaatgat
gctggagagactgacccagctaagagtgttctgaaactcctctccgacttcttagacagc
gaggtatctgaactcaggacaggagctgcagaaggactagccaagctgatgttttctggg
cttttggtcagcagcaggattctttctcgtcttattttgttatggtataatcctgtgact
gaagaggatgttcgacttcgacattgcctaggagtgtttttccccatgtttgcttatgca
aacaggactaatcaggagtgctttgaagaagcctttattccaactgtgcaaacactggcc
aatgccccagtgtcatctcctttagctgaagtagatgtcacaaatgttgttgaattgctt
gttgatctgacaagaccaagtagattaaatcctaaggcaaagaattctcaggattatcag
gccttaacagtacatgacaacttggctataaaaatttgcaatgagatcttaacaagtcca
tgctcaccagaaaatcgggtttatacaaaagctttgagtttggtcgaactcagtagcaat
gttacaaaagatctcctgcttctattggatgagattctggagcatgtaacagataggacg
tgtctgagagccttggagaagattaagagtcagttaggaaagggaggtaaagaatctgac
ccaggtgtagtaacacaggatgtcaacacaaccacagcagttcttcaaaatgaaaacgaa
tatatgactcctgtgagggatggaaaaggaactcaaacatcaaaatctacacaaggaaaa
tctaaaagaggatgtagaaaagcgccagtttcatctaagaccaacaggagacgccagatt
gctgggccagactctgaaagtgatcatgaaccaccatcagaaatgaagatgagattaccc
agacgagccaaaacagctgcgctacagaaaagtaaacttaaccttgcagagttccttaat
gaagatacaagttaa

DBGET integrated database retrieval system