KEGG   Mus musculus (house mouse): 54393
Entry
54393             CDS       T01002                                 
Symbol
Gabbr1, GABAB1, GABAbR1, bM573K1.1
Name
(RefSeq) gamma-aminobutyric acid (GABA) B receptor, 1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu04915  Estrogen signaling pathway
mmu04929  GnRH secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    54393 (Gabbr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    54393 (Gabbr1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    54393 (Gabbr1)
   04915 Estrogen signaling pathway
    54393 (Gabbr1)
  09156 Nervous system
   04727 GABAergic synapse
    54393 (Gabbr1)
  09157 Sensory system
   04742 Taste transduction
    54393 (Gabbr1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    54393 (Gabbr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    54393 (Gabbr1)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  GABA
   54393 (Gabbr1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Sushi UPF0242 DUF3995 NEMP
Other DBs
NCBI-GeneID: 54393
NCBI-ProteinID: NP_062312
MGI: 1860139
Ensembl: ENSMUSG00000024462
UniProt: Q9WV18
Position
17:37356858..37385197
AA seq 960 aa
MLLLLLVPLFLRPLGAGGAQTPNVTSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDY
EIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPA
LDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGG
WPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKII
LMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLF
EKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARI
IVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEG
HITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALAL
NKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQ
LQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSL
GIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRSQFPF
VCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMD
ILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLL
LLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAI
VFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKI
IAEKEERVSELRHQLQSRQQIRSRRHPPTPPDPSGGLPRGPSEPPDRLSCDGSRVHLLYK
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctggtgcctctcttcctccgccccctgggcgctggcggggctcag
acccccaacgtcacctcggaaggttgccagattatacatccgccctgggaaggtggcatc
aggtaccgtggcttgactcgcgaccaggtgaaggccatcaatttcctgcctgtggactat
gagattgaatatgtgtgccggggcgaacgcgaggtggtggggcccaaggtgcgcaagtgc
ctggccaacggctcctggacggatatggacacacccagtcgctgtgtccgaatctgctcc
aagtcttatttgaccctggaaaatgggaaggttttcctgacgggtggggacctcccagct
ctggatggagcccgggtggatttccgatgtgaccccgacttccatctggtgggcagctcc
cggagcatctgtagtcagggccagtggagcacccccaagccccactgccaggtgaatcga
acgccacactcagaacggcgtgcagtatacatcggggcgctgtttcccatgagcgggggc
tggccggggggccaggcctgccagcctgcggtggagatggcgctggaggacgttaacagc
cgcagagacatcctgccggactacgagctcaagcttatccaccacgacagcaagtgcgac
ccagggcaagccaccaagtacttgtatgaactactctacaacgaccccatcaagatcatc
ctcatgcccggctgcagctctgtgtccacactggtagccgaggctgcccggatgtggaac
cttattgtgctctcatatggctccagctcaccagccttgtcaaaccgacagcggtttcca
acgttctttcggacacatccatccgccacactccacaatcccacccgggtgaaactcttc
gaaaagtggggctggaagaagattgccaccatccagcagactaccgaggtcttcacctca
acactggatgacctggaggagcgagtgaaagaggctgggattgagatcacttttcgacag
agtttcttctcagatccagctgtgcctgttaaaaacctgaagcgtcaagatgctcgaatc
atcgtgggacttttctatgagaccgaagcccggaaagttttttgtgaggtctataaggaa
cggctctttgggaagaagtatgtctggtttctcatcgggtggtatgctgacaactggttc
aaaacctatgacccgtcaatcaattgtacagtagaagagatgactgaggcggtggagggc
catatcaccacggagattgtcatgctgaaccctgccaacacccgaagcatttccaacatg
acatcacaggaatttgtggagaaactaaccaagcggctgaaaagacaccctgaggagact
ggaggcttccaggaggcaccactggcctatgatgctatctgggccttggctttggccttg
aacaagacctctggaggaggtggccgttcaggagtgcgcctggaggactttaactacaac
aaccagaccattacagaccaaatctaccgggccatgaactcctcctcctttgagggtgtt
tctggccacgtggtctttgatgccagcggctcccggatggcatggacgcttatcgagcag
ctacagggcggcagctacaagaagatcggctactacgacagcaccaaggatgatctttcc
tggtccaaaacagacaagtggatcggagggtctcccccagccgaccagaccttggtcatc
aagacattccgtttcctgtcacagaaactctttatctccgtctcagttctctccagcctg
ggcattgttcttgctgttgtctgtctgtcctttaacatctacaactcccacgttcgttat
atccagaactcccagcccaacctgaacaatctgactgctgtgggctgctcactggcacta
gctgctgtcttcccccttgggctggatggttaccacatagggagaagccagttcccattt
gtctgccaggcccgcctttggctcttgggcttaggctttagtctgggctatggctctatg
ttcaccaagatctggtgggtccacacagtcttcacaaagaaggaggagaagaaggaatgg
aggaagaccctagagccttggaaactgtacgccactgtaggcctgctggtgggcatggat
atcctgactcttgccatctggcagattgtggaccccttgcaccgaaccattgagactttt
gccaaggaggaaccaaaggaagacattgatgtctccattctgccccagctggagcactgc
agctccaagaagatgaatacatggctcggcattttctatggttacaaagggctgctgctg
ctgctgggaatctttcttgcttatgagaccaaaagtgtgtccactgaaaagatcaatgac
cacagggccgtgggcatggctatctacaatgttgcggtcctgtgtctcattaccgctcct
gtcaccatgatcctttccagccagcaggacgcagccttcgcctttgcctctctggccatt
gtgttctcttcctacattactctggttgtgctctttgtgcctaagatgcgcaggttgatc
actcgaggtgaatggcagtctgaagcacaggacacaatgaaaacaggatcatccaccaac
aacaatgaggaagagaagtcccgactgttggagaaggaaaaccgtgaattggaaaagatc
atcgccgagaaagaggagcgtgtctctgaactgcgccatcagctccagtctcggcagcag
atccgctcccggcgccaccccccaacacccccagacccctctgggggccttcccagggga
ccctcagagccccctgaccggcttagctgtgatgggagtcgagtacatttgctttacaag
tga

DBGET integrated database retrieval system