KEGG   Mus musculus (mouse): 54397
Entry
54397             CDS       T01002                                 

Gene name
Ppt2, 0610007M19Rik, AA672937
Definition
(RefSeq) palmitoyl-protein thioesterase 2
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    54397 (Ppt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    54397 (Ppt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    54397 (Ppt2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     54397 (Ppt2)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   54397 (Ppt2)
SSDB
Motif
Pfam: Palm_thioest Abhydrolase_1 Abhydrolase_6 DUF676 PGAP1 Lipase_2 Hydrolase_4
Other DBs
NCBI-GeneID: 54397
NCBI-ProteinID: NP_001289322
MGI: 1860075
Ensembl: ENSMUSG00000015474
Vega: OTTMUSG00000035857
UniProt: O35448
Position
17 B1; 17 18.19 cM
AA seq 302 aa
MPGLWRQRLPSAWALLLLPFLPLLMPAAPAAHRGSYKPVIVVHGLFDSSYSFRHLLDYIN
ETHTGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMEKAPEGVHLICYSQGGLVCRAL
LSVMDNHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRVCYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYDTCIEPW
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccggggctatggaggcagaggcttccttcggcttgggctttgcttctcctgccgttc
ctgccgctgctgatgcccgcagcccccgcagcccaccgcgggtcctacaagcccgtgatc
gtggtgcacgggctctttgacagttcatacagcttccgccacctgctggactatatcaat
gagacacacaccgggactgtggtgacagtgcttgatctcttcgatggcagagagagtttg
cggcccctgtgggaacaggtacaagggttccgagaggctgtggtccccatcatggaaaag
gcccctgaaggagtgcacctcatctgctactcccaggggggcctggtgtgccgtgctttg
ctgtctgtcatggataaccacaatgtggactctttcatctccctctcctccccacagatg
ggccagtatggagacacggactatttgaaatggctcttccccacgtccatgcggtctaac
ctctatcgggtctgctatagtccttggggccaggaattttccatttgcaactactggcac
gatcctcaccacgatgacttgtacctcaatgccagcagctttctggccctcatcaatggg
gaaagagaccatcccaatgccactgcatggcggaagaacttccttcgcgtgggccgtctg
gtgctgattgggggtcctgatgatggcgttatcactccctggcaatctagcttctttggt
ttctatgatgccaatgagacagttctggagatggaggagcagccggtgtatcttcgagat
tcttttgggttgaagactctcctggcccggggggccatagtgaggtgtcccatggctggc
atctctcacaccacgtggcactctaaccgtacgctctacgatacttgcattgagccgtgg
ctctcctga

DBGET integrated database retrieval system