KEGG   Mus musculus (mouse): 54402
Entry
54402             CDS       T01002                                 

Gene name
Stk19, G11, R, RP1
Definition
(RefSeq) serine/threonine kinase 19
  KO
K08880  serine/threonine kinase 19 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    54402 (Stk19)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     54402 (Stk19)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  G11 family
   54402 (Stk19)
SSDB
Motif
Pfam: Stk19
Other DBs
NCBI-GeneID: 54402
NCBI-ProteinID: NP_062315
MGI: 1860085
Ensembl: ENSMUSG00000061207
Vega: OTTMUSG00000033101
UniProt: Q9JHN8 Q3TG64
Position
17; 17 B1
AA seq 254 aa
MNRKRRLLASEAFGVKRRRAPGPVRADPLRTRAGSAREAIEELVKLFPRGLFEDALPPIA
LRSQVYSLVPDRTVADLQLKELQELGEIRIIQLGFDLDAHGIVFTEDYRTRVLKACDGRP
CAGAVQKFLASVLPACGDLSFQQDQMTQTYGFRDPEITQLVNAGVLTVRDAGSWWLAVPG
AGRFIKCFVKGRQAVLSMVRKAKYRELALSELLGRRAPLAVRLGLAYHVHDLIGAQLVDC
VPTTSGTLLRLPDT
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaatcgcaagagacggctcctggcgtctgaggcttttggggtgaagcggaggcgggcg
ccggggcccgtgagagcggatcctttaagaacaagagcaggctcggcgcgcgaggccatc
gaggagctcgtgaagctgtttccccgggggctgttcgaggatgcgctgccgcccatcgcg
ctgaggagccaagtgtacagtctggtgccagaccggacggtggccgacctacaactgaag
gagcttcaagagctgggagagatccgaattatccagctaggctttgacttggatgctcat
gggattgtcttcacggaagactacaggacccgggtcctcaaggcctgtgatggccgacca
tgtgctggggcggtgcagaagttcctggcctcagtgctcccagcctgtggggacctcagt
ttccagcaggatcagatgacacagacttatggcttcagggacccggagatcacgcagctg
gtgaacgctggggtcctcactgtccgagatgctggaagctggtggctggctgtgcctgga
gctgggagattcatcaagtgctttgttaaagggcgccaggctgtactgagcatggtgcgg
aaggccaagtaccgggagcttgccttgtcagagctcctgggccgcagggcccctttggca
gtgcggctaggtcttgcctaccatgtgcacgacctcattggagcccagctggtggactgt
gtccccaccacttctggaaccctccttcgcctgccagatacatga

DBGET integrated database retrieval system