KEGG   Mus musculus (house mouse): 54420
Entry
54420             CDS       T01002                                 
Symbol
Cldn8
Name
(RefSeq) claudin 8
  KO
K06087  claudin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54420 (Cldn8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54420 (Cldn8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    54420 (Cldn8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    54420 (Cldn8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    54420 (Cldn8)
   04147 Exosome [BR:mmu04147]
    54420 (Cldn8)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   54420 (Cldn8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   54420 (Cldn8)
  Exosomal proteins of colorectal cancer cells
   54420 (Cldn8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF6338 Clc-like
Other DBs
NCBI-GeneID: 54420
NCBI-ProteinID: NP_061248
MGI: 1859286
Ensembl: ENSMUSG00000050520
UniProt: Q9Z260 Q3UZK2
Position
16:complement(88357714..88360071)
AA seq 225 aa
MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANI
RMQCKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILL
TAGIIFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGA
LFCCVFCCTERSNSYRYSVPSHRTTQRSFHAEKRSPSIYSKSQYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcaacctacgctcttcaaatggctgcactggtgcttggtggtgttggcatggtgggc
acggtggctgtgactatcatgcctcagtggagagtgtctgccttcatcgaaagtaacatt
gtggtgtttgagaaccgctgggaaggcttgtggatgaattgtatgaggcatgccaacatc
agaatgcagtgcaaggtctacgactccctgctggctcttagtccagacctccaggcatcc
cgaggactgatgtgtgctgcgtccgtcttggctttcttggctttcatgacagccatcctc
ggaatgaagtgcaccagatgcacgggggacgatgagaacgtgaagagccgcatcttgctg
acagccggaatcatcttcttcatcaccggcttggttgtgctcatccctgtcagctgggtt
gccaattccatcatcagagacttctacaacccactggtggatgtggccctaaagcgcgag
ctgggagaagccctctacataggctggaccacagcgctggtgctgatcgctggaggagca
ctgttctgttgtgtgttttgttgtactgaaaggagcaacagttacaggtactcggtacca
tcccatcgcaccactcaacggagtttccacgccgaaaagagatctccgagcatatactcc
aaaagtcagtatgtgtag

DBGET integrated database retrieval system