KEGG   Mus musculus (mouse): 54450
Entry
54450             CDS       T01002                                 

Gene name
Il1f5, AI413231, Fil1delta, IL-36Ra, IL36RN, Il-1h3, Il1hy1
Definition
(RefSeq) interleukin 1 family, member 5 (delta)
  KO
K05483  interleukin 36 receptor antagonist protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    54450 (Il1f5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    54450 (Il1f5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   54450 (Il1f5)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 54450
NCBI-ProteinID: NP_001139559
MGI: 1859325
Ensembl: ENSMUSG00000026983
Vega: OTTMUSG00000011958
UniProt: Q9QYY1
Structure
PDB: 
1MD6

Position
2 A3; 2 16.31 cM
AA seq 156 aa
MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVIL
GVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGW
FLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
NT seq 471 nt   +upstreamnt  +downstreamnt
atgatggttctgagtggggcactatgcttccgaatgaaggattcagccttgaaggtactg
tatctgcacaataaccagctgctggctggaggactgcacgcagagaaggtcattaaaggt
gaggagatcagtgttgtcccaaatcgggcactggatgccagtctgtcccctgtcatcctg
ggcgttcaaggaggaagccagtgcctatcttgtgggacagagaaagggccaattctgaaa
cttgagccagtgaacatcatggagctctacctcggggccaaggaatcaaagagcttcacc
ttctaccggcgggatatgggtcttacctccagcttcgaatccgctgcctacccaggctgg
ttcctctgcacctcaccggaagctgaccagcctgtcaggctcactcagatccctgaggac
cccgcctgggatgctcccatcacagacttctactttcagcagtgtgactag

DBGET integrated database retrieval system