KEGG   Mus musculus (mouse): 54473
Entry
54473             CDS       T01002                                 

Gene name
Tollip, 4930403G24Rik, 4931428G15Rik
Definition
(RefSeq) toll interacting protein
  KO
K05402  toll-interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    54473 (Tollip)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    54473 (Tollip)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   54473 (Tollip)
  Exosomal proteins of bladder cancer cells
   54473 (Tollip)
SSDB
Motif
Pfam: CUE C2 UBA HTH_8
Other DBs
NCBI-GeneID: 54473
NCBI-ProteinID: NP_076253
MGI: 1891808
Ensembl: ENSMUSG00000025139
Vega: OTTMUSG00000023241
UniProt: Q9QZ06
Position
7; 7 F5
AA seq 274 aa
MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGTVGTVGRLSITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLKQGQVEDEWYSLSGRQGDDKEGMINLVMSYTSLPAAMM
MPPQPVVLMPTVYQQGVGYVPIAGMPAVCSPGMVPMAMPPPAVAPQPRCNEEDLKAIQDM
FPNMDREVIRSVLEAQRGNKDAAINSLLQMGEES
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcgaccaccgtcagcacgcagcgcgggccggtgtacattggtgaactcccccaggac
ttcctccgtataacacccacacaacagcagcagcagatccagctggatgcccaggcagcc
cagcagctgcagtatggaggaacagttggtaccgtgggtcgcctcagcatcactgtggta
caggcaaaattggcaaagaattatggcatgactcgtatggacccttactgccgtctgcgt
ctgggctatgctgtttatgaaactcccacagcacacaatggggccaagaaccctcgctgg
aacaaagtcattcagtgcacagtgcccccaggtgtggactcgttctaccttgagatcttc
gatgagcgcgccttctccatggatgaccgcatagcttggacccacatcaccatccccgag
tccctgaagcagggccaagtggaggacgagtggtatagcctgagtgggaggcagggcgat
gacaaggagggcatgattaacctggtcatgtcctacacgtccctcccagctgccatgatg
atgcctcctcagcctgtggtcctgatgccaactgtgtaccagcagggtgttggctatgtg
cccattgcagggatgcctgctgtctgcagccctggcatggtgccgatggccatgccccca
ccagctgtggctcctcagccccgctgtaatgaagaggacctcaaagctatccaggacatg
tttcccaacatggacagggaagtaatccgttctgtgcttgaagcccagagagggaacaaa
gatgctgccatcaattccttgctgcaaatgggtgaagagtcctag

DBGET integrated database retrieval system