KEGG   Mus musculus (mouse): 544792Help
Entry
544792            CDS       T01002                                 

Gene name
Gsg1l2, Gm12302
Definition
(RefSeq) GSG1-like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: GSG-1 PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 544792
NCBI-ProteinID: NP_001333986
MGI: 3650209
Ensembl: ENSMUSG00000097886
Vega: OTTMUSG00000042561
UniProt: M0QWL6
Position
11; 11 B3
AA seq 290 aa AA seqDB search
MDRARWQRMLTLLPICLALAFSLTAMGSSHWCEGIRRMTKPLCQDLLGGLNCIHFSRSSS
STGSKHDDSQAVQYIWETGDDKFIQRRFHAGLWQSCEESLNSTGERCRCFLGIVPAEGQG
VLWLSIGAEVLDIFLILTGVILLGFSMSCYSSGCSWLNVDASVAILMVLAGLLGMVAHMM
YTTSFQITVNLGPEDWRPQTWDYGWSYCLAWGSFALCMAVSVATMSRYTTAQAEVPRAQK
GGPYPQHNTPQPGPSRKVWQTGATPHPVGHIFTNVPGHPPPGTGGKVSMC
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacagggcgaggtggcagcggatgctgaccctcctccccatctgcctggcccttgcc
ttctccctcacagccatgggcagcagccactggtgcgaggggatccgacgaatgacaaaa
cctctatgccaggatctcctcgggggcttgaactgcattcacttcagccggtccagcagc
agcacgggcagtaagcacgatgacagccaggctgtccagtacatctgggagacaggggac
gacaagtttatccaacgcaggttccatgcggggctttggcagtcctgtgaggaaagcctc
aacagcacaggtgagcggtgcaggtgcttcctggggatagtacccgccgagggacaagga
gttttatggctctccattggggctgaagtcttggatatcttcctgatactgacaggtgtc
atcctcctgggcttcagcatgagttgttacagttccggatgcagctggctcaacgtggac
gcctcagtggctatcctcatggtgcttgcaggactcctgggcatggtggctcacatgatg
tacacaactagttttcaaatcaccgtgaacctaggaccagaagattggcggcctcagaca
tgggactatggctggtcctattgtcttgcctggggatcttttgctctctgtatggctgtt
tcagtggcgaccatgagcagatacaccacagcccaagcagaggtgccaagggcacagaaa
ggtggtccataccctcagcacaacaccccacagcctggaccttcacggaaggtttggcaa
acaggagcgactccccatcctgtgggacacatcttcacgaatgttcctgggcacccgccc
ccaggtacaggaggcaaagtgtccatgtgctag

DBGET integrated database retrieval system