KEGG   Mus musculus (mouse): 54486Help
Entry
54486             CDS       T01002                                 

Gene name
Hpgds, H-PGDS, Ptgds2
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    54486 (Hpgds)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    54486 (Hpgds)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54486 (Hpgds)
   00982 Drug metabolism - cytochrome P450
    54486 (Hpgds)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54486 (Hpgds)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     54486 (Hpgds)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     54486 (Hpgds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_N_2 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 54486
NCBI-ProteinID: NP_062328
MGI: 1859384
Ensembl: ENSMUSG00000029919
Vega: OTTMUSG00000035987
UniProt: Q9JHF7
Position
6; 6 C1
AA seq 199 aa AA seqDB search
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLT
IHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELL
THQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNK
VQAIPAISAWILKRPQTKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcctaactacaaactgctttattttaatatgaggggaagagccgaaattattcgctac
atattcgcttatttggacataaagtatgaggatcacagaatagaacaagctgactggcct
aaaatcaagccaactcttccatttggcaaaatccctgttttggaggtggaaggacttaca
atccaccagagcctcgcaatagcaagatatttgaccaaaaacacagatttggctgggaag
acagcgttggagcaatgtcaagctgatgcagtggtggacacgctggatgacttcatgtct
ctcttcccatgggcagagaaagatcaagatctaaaagagcggatgttcaatgaattgctc
acacatcaagcacctcgccttctgaaagatttggacacatacttaggagacaaagagtgg
tttataggcaattatgtaacctgggcagacttctactgggatatctgcagcaccacactt
ttggttttaaagcctggcttgttggatatctaccccaaactggtgtcattacggaacaaa
gtccaagctatccctgccatttctgcctggatactaaagaggccacagacaaaactctag

DBGET integrated database retrieval system