KEGG   Mus musculus (house mouse): 544922
Entry
544922            CDS       T01002                                 
Symbol
Zkscan4, Gm11272
Name
(RefSeq) zinc finger with KRAB and SCAN domains 4
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    544922 (Zkscan4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    544922 (Zkscan4)
SSDB
Motif
Pfam: zf-H2C2_2 SCAN zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf_UBZ zf-C2H2_11 Zn-ribbon_8 zf-C2HC_2 zinc_ribbon_15 C1_4
Other DBs
NCBI-GeneID: 544922
NCBI-ProteinID: NP_001034204
MGI: 3649412
Ensembl: ENSMUSG00000054931
UniProt: Q5SZT6
Position
13:21663019..21669677
AA seq 480 aa
MAREPGTSAALNARSAEEGTGLLVVKVEQEEASPLAEETSWLGSPGPDRSRQRFRAFRYP
EAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQTWVREQHPDSGE
EVVALLEYLDRQLDDTPPQVSTGEWSRELLCCKVAVVTPSQDSQSSHCQAMKSLFKHESQ
ESLECSPLQARGLEMKPETRDLPRAEEYRDQKPEQTVCFLGEDTVPIPTGAEASEQEGKL
QTAQKSATGTRRHFCCECGKSFAQSSGLTKHKRIHTGEKPYECEDCGKTFIGSSALVIHQ
RVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFTQSCSLLEHHKIHT
GEKPFQCNLCGKAFRRSSHLLRHQRIHGDKTAPKPLHGEAWEGQSPVAGQGEDVEAPETY
QCSECERSFTRRRSLLEHKKIHTGEKPYQCDACGKGFTRTSYLAQHQRSHVGKKLSHSDL
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctagagaacccggaacgtccgcagccctaaacgctcggtctgcagaagagggcact
gggcttctagtggtgaaagtggaacaggaagaggcctcccccttggcagaggagaccagt
tggctgggcagtcctgggcctgaccgctcccgccagcgcttccgtgctttccgctaccca
gaggcagccggaccccggcaggcgctgagccggctccgcgagctctgcagacagtggctg
cggccagacatgcacagcaaggagcagatcctggagctgctggtgctggagcagttcctg
accatcctgccaggggagctgcagacctgggtgcgcgagcagcaccccgacagcggggag
gaggtggtggcgctgctggagtacttggacaggcagctggatgacacacctccacaggtt
tcaacgggagaatggagtcgcgaacttctctgctgcaaggtggcagtggtgacaccatcc
caggactcacaaagtagccactgccaggcaatgaagtcactcttcaagcacgaatctcag
gaatctttggagtgttcgcccttacaggccagagggctggaaatgaagcctgagaccagg
gacttgcctcgagctgaagaatacagggaccaaaagcctgagcagacagtgtgcttcctg
ggtgaagacactgtcccgattcctacaggtgcagaagccagtgagcaggaaggcaagtta
cagacagcacagaagagtgccacaggaaccaggcggcacttttgctgtgaatgtgggaag
agctttgctcagagttcaggcttgaccaaacacaagagaatccacacaggagagaagccc
tatgaatgtgaagactgtgggaagacctttattgggagctctgcccttgtcattcatcag
agagttcacactggggagaagccatatgagtgtgaagaatgtggcaaagtcttcagtcac
agctccaacctcatcaagcaccagagaacccacactggggaaaagccctacgagtgtgat
gactgtgggaaaaccttcactcagagctgcagcctccttgaacatcacaaaattcacact
ggggagaagccattccagtgcaacttgtgtggcaaagcctttaggcgtagctcacatctc
ctgagacatcagcggatccatggtgataaaactgctccaaagcctctgcatggagaggcc
tgggaaggtcagagtccggtggcaggccagggggaagatgttgaagctcctgagacttac
cagtgcagtgagtgtgagagaagtttcactcggaggagaagccttcttgaacataaaaaa
atccacacgggtgagaaaccctaccagtgtgatgcatgcgggaagggctttacccgaact
tcataccttgctcaacatcagaggagccacgtggggaaaaaattgtctcacagtgatctg
tag

DBGET integrated database retrieval system